SecReT6
Protein ID: 384127012
SecReT6 ID576
T6SS typei3
Gene symbol-
Locus tagYPD8_2560
StrainYersinia pestis D182038
Repliconchromosome [GenBank: NC_017160] [Browse all T6SS(s) in this replicon]
Location [Strand]3253631..3254467 [-]
ProductOmpA family protein
NoteTssL
UniProt IDD0JP01
KEGG IDypx:YPD8_2560
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.90E-18, Aligned region: 18..111
OmpA [PF00691], Evalue: 1.70E-16, Aligned region: 172..270
Protein Sequence: 278 a.a.     [Download]
>gi|384127012|ref|YP_005509626.1| OmpA family protein [Yersinia pestis D182038]
MGRWWRYKWITFHPSLTYADGLEVLLRILGLGFEGRYSIIEDGDRQLTKIRQGLLTLLQSTRDTIPPALS
PHGLIAHQNRRRRGIFVPVRVSMLLCGFLIVATFIGCKYFLSVPESDLLKRMGALQRVVVTPPVAAPKLR
LSILLKDEIAKQLVSVDETSNNSKVIFKGDSMFMVGSDNVRPEMIDVIKRVAQEVHRVKGAILIVGHTDS
MPINKPGFPNNQVLSEKRAANVARYMEQAGIPTDKIRFEGKGETQPVSSNDDATGRSQNRRVEIFVNY
 
Nucleotide Sequence: 837 bp     [Download]
>gi|384124469|ref|NC_017160.1|:c3254467-3253631 Yersinia pestis D182038 chromosome, complete genome
TTGGGCCGTTGGTGGAGATATAAGTGGATCACTTTTCATCCGTCGTTGACATATGCGGATGGTTTAGAGG
TTTTGCTGCGCATTTTAGGGCTCGGTTTTGAGGGGCGCTACAGCATTATCGAAGATGGTGATCGGCAATT
AACTAAAATACGCCAAGGGTTGCTGACGCTGCTCCAAAGTACCCGAGACACGATCCCACCGGCACTTTCT
CCGCATGGGTTGATCGCACATCAAAACAGAAGACGGCGGGGCATTTTTGTTCCGGTGCGCGTATCCATGC
TGTTGTGTGGTTTCCTCATTGTCGCGACCTTTATTGGATGTAAATACTTTCTCTCGGTACCGGAAAGTGA
CTTGCTAAAAAGAATGGGAGCATTGCAACGTGTGGTTGTGACGCCACCCGTTGCCGCACCAAAACTTCGA
CTGTCTATTTTATTAAAAGATGAGATAGCGAAGCAGTTAGTCAGTGTTGATGAAACGAGCAACAACAGCA
AAGTCATCTTTAAAGGCGACTCTATGTTTATGGTCGGCTCGGATAACGTCAGACCTGAAATGATTGACGT
AATTAAACGCGTCGCGCAGGAAGTGCATCGCGTTAAAGGGGCAATCCTCATCGTCGGGCATACAGACTCT
ATGCCGATTAATAAACCCGGCTTCCCTAATAACCAGGTACTTTCCGAAAAACGCGCGGCCAATGTTGCAC
GCTATATGGAGCAGGCCGGTATTCCAACCGACAAAATTCGGTTTGAGGGCAAGGGGGAAACGCAACCGGT
TAGCAGCAATGACGATGCGACAGGACGTTCGCAAAACCGCCGCGTAGAAATTTTTGTTAATTATTGA