SecReT6
Protein ID: 384127015
SecReT6 ID576
T6SS typei3
Gene symbol-
Locus tagYPD8_2563
StrainYersinia pestis D182038
Repliconchromosome [GenBank: NC_017160] [Browse all T6SS(s) in this replicon]
Location [Strand]3256298..3256903 [-]
ProductDotU family type IV / VI secretion system protein
NoteTssL
UniProt IDD0JP04
KEGG IDypx:YPD8_2563
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.30E-29, Aligned region: 65..177
Protein Sequence: 201 a.a.     [Download]
>gi|384127015|ref|YP_005509629.1| DotU family type IV / VI secretion system protein [Yersinia pestis D182038]
MDESPQALGRFLLDEPMTSPDSTQDNTAFTREAPHSGAAQQYDTTLLRGESVQQRVAKVLASSTPLLEAA
QPLLRALSEMPAHIGDVSQVHILKQSLKNEITLFSVVCDEADISWKKMAIVRYCLCTALDEAAHTMSWGM
MAGWSQSNLLNHFEGDNDGGNKFFLLVGRLSMSPHEYAVTNGAIVIHTQRLKSDPGGNLLS
 
Nucleotide Sequence: 606 bp     [Download]
>gi|384124469|ref|NC_017160.1|:c3256903-3256298 Yersinia pestis D182038 chromosome, complete genome
GTGGATGAGAGTCCGCAGGCATTAGGCCGGTTCTTGCTTGATGAGCCAATGACATCCCCAGATAGCACTC
AGGATAATACGGCCTTCACTAGAGAGGCCCCTCATTCTGGTGCGGCACAGCAATATGACACGACCCTCTT
ACGGGGTGAAAGTGTGCAACAGCGTGTCGCTAAAGTACTCGCATCTTCAACGCCATTATTGGAAGCGGCA
CAGCCACTATTACGTGCCTTGAGCGAGATGCCCGCGCATATTGGGGATGTTTCACAGGTTCATATATTAA
AACAAAGCCTTAAAAATGAGATCACCCTCTTTAGTGTGGTGTGTGATGAAGCGGATATCTCATGGAAAAA
AATGGCTATCGTCCGCTATTGCCTGTGTACTGCGTTGGATGAAGCCGCTCACACGATGTCGTGGGGAATG
ATGGCAGGTTGGTCACAAAGCAACCTGTTGAACCATTTTGAAGGCGATAATGACGGCGGGAATAAGTTTT
TCTTATTGGTCGGCCGTCTCTCTATGAGCCCGCATGAATATGCTGTAACGAACGGTGCAATAGTGATCCA
CACCCAACGCCTGAAATCAGATCCAGGGGGTAATCTGCTCTCCTGA