SecReT6
Protein ID: 384127016
SecReT6 ID576
T6SS typei3
Gene symbol-
Locus tagYPD8_2564
StrainYersinia pestis D182038
Repliconchromosome [GenBank: NC_017160] [Browse all T6SS(s) in this replicon]
Location [Strand]3256963..3258312 [-]
Producthypothetical protein
NoteTssK
UniProt IDD0JP05
KEGG IDypx:YPD8_2564
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.50E-144, Aligned region: 19..447
Protein Sequence: 449 a.a.     [Download]
>gi|384127016|ref|YP_005509630.1| hypothetical protein YPD8_2564 [Yersinia pestis D182038]
MRTNKVVWSEGLFLRPQLFQQQERYLEYYAHKRAATITPFFWGFAQYEIDREALSYGKLVLRSGKGVLPD
GTPFDIPGHAELPEPLTITPEHLGKLIYLAVPLRLDNSDETIFDEHDMSSLARFYAYEAALNDTNAIRQG
PKPVQLSRLRLRLVSEGEMTESWIGLPLTKVRAIQPDGSVLLHTEDYIPPVTGYAASSLLSEWLTHLNGL
VKMRAEMLANRLSNSDGKASASAEIVDYLLLQIFNKYEPILDHLRHIPELPPITLYQELAKFSGELSTFI
RTKTRRPRPAPGYDHAKLYASIRPLVDEVHELLNQILVRAGQMIPLETKGNGVWSASVLPNELRSFSNLV
LAVHAQLPMDVLQHQFSVQTKISAPQQLHELVRSHLPGLELQRLPVPPRQIPYSAGYVYFELIKNGPFWD
KVSNAGAIALHVAGDFPALKMELWGIRDS
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|384124469|ref|NC_017160.1|:c3258312-3256963 Yersinia pestis D182038 chromosome, complete genome
GTGAGAACTAACAAAGTCGTTTGGAGTGAGGGGCTTTTTCTTCGCCCACAACTTTTTCAACAGCAAGAGC
GCTATCTTGAATATTACGCCCATAAGCGAGCTGCAACGATAACCCCATTCTTTTGGGGATTTGCGCAATA
TGAAATTGATAGAGAAGCACTCTCGTATGGCAAATTAGTATTGCGATCTGGGAAGGGCGTGTTACCCGAC
GGTACACCATTTGATATTCCCGGCCATGCTGAATTGCCTGAACCGCTCACTATCACCCCAGAACATCTGG
GTAAGTTGATCTATCTGGCGGTACCACTGCGCCTGGATAACAGTGATGAAACCATTTTTGATGAGCACGA
TATGAGCTCATTGGCACGTTTTTACGCCTATGAAGCTGCGCTCAACGATACCAATGCCATTCGGCAAGGG
CCGAAGCCGGTACAACTGTCAAGATTACGTCTCAGATTAGTCTCAGAAGGTGAGATGACAGAATCATGGA
TTGGGCTGCCATTAACCAAAGTCAGAGCGATTCAGCCTGATGGGAGTGTCTTGCTACACACCGAAGACTA
TATTCCTCCGGTGACGGGTTATGCCGCAAGTTCATTGCTGTCTGAATGGCTAACCCATCTTAATGGTTTG
GTTAAAATGCGCGCAGAGATGTTGGCCAATCGCTTGTCAAACAGTGATGGGAAAGCGAGCGCCAGCGCAG
AAATTGTCGATTATTTGTTACTGCAAATTTTTAATAAATATGAGCCGATTCTCGATCATTTAAGGCATAT
TCCTGAATTACCGCCTATTACGCTTTATCAGGAATTGGCTAAGTTCTCGGGGGAATTATCTACCTTTATC
CGGACCAAAACCCGCCGACCCCGCCCGGCACCTGGCTATGATCATGCGAAGCTCTATGCGTCTATTCGTC
CGTTGGTTGACGAAGTTCATGAACTACTGAACCAGATCTTGGTGCGTGCTGGGCAGATGATACCGCTGGA
GACGAAAGGCAATGGCGTTTGGTCTGCCTCCGTACTGCCTAATGAATTACGCTCGTTTTCAAATCTGGTC
CTTGCCGTTCATGCGCAATTACCGATGGATGTGCTACAGCATCAATTTTCAGTACAAACAAAAATCAGCG
CACCTCAGCAATTGCATGAACTGGTGCGATCGCATTTGCCAGGGTTGGAACTACAGCGTTTGCCGGTACC
GCCCAGACAAATTCCGTATAGCGCAGGGTACGTTTATTTTGAATTGATAAAAAATGGCCCCTTCTGGGAC
AAAGTTTCCAATGCTGGTGCCATTGCCCTGCATGTGGCGGGTGATTTCCCTGCCTTGAAAATGGAGCTCT
GGGGGATTAGAGATTCATGA