SecReT6
Protein ID: 384127017
SecReT6 ID576
T6SS typei3
Gene symbol-
Locus tagYPD8_2565
StrainYersinia pestis D182038
Repliconchromosome [GenBank: NC_017160] [Browse all T6SS(s) in this replicon]
Location [Strand]3258316..3258855 [-]
Producttype VI secretion lipoprotein, family
NoteTssJ
UniProt IDD0JP06
KEGG IDypx:YPD8_2565
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.50E-36, Aligned region: 22..172
Protein Sequence: 179 a.a.     [Download]
>gi|384127017|ref|YP_005509631.1| type VI secretion lipoprotein, family [Yersinia pestis D182038]
MNKSIRGVYRATQYLFLVLVTLLTIACSSKVQPEKAEKLTVEIATAADINPNDKGVANPLRIALYTLKST
DEFQSSDFFTITEENTPSLKEQMDNVFDRIMLPSETKKIELTLDAGVTAIGIVAAYREIEQAEWKAVIYP
LPKKRVDPWYKKMWPGQDQQDPIMKVRVERLSISIKEMD
 
Nucleotide Sequence: 540 bp     [Download]
>gi|384124469|ref|NC_017160.1|:c3258855-3258316 Yersinia pestis D182038 chromosome, complete genome
ATGAATAAAAGTATCCGAGGGGTTTACCGGGCGACACAGTACTTATTTTTGGTACTGGTAACGTTATTGA
CGATAGCCTGTAGTTCAAAAGTGCAACCTGAAAAGGCTGAAAAGCTTACCGTCGAAATCGCGACAGCAGC
GGATATTAATCCGAATGATAAAGGGGTGGCGAACCCGCTAAGGATTGCACTTTATACACTCAAGAGCACC
GATGAATTTCAGTCGAGTGATTTCTTCACTATCACTGAAGAAAATACGCCATCGCTAAAAGAACAAATGG
ATAACGTGTTTGACCGGATTATGTTGCCAAGCGAGACCAAAAAAATAGAGCTGACACTTGATGCTGGCGT
TACTGCTATCGGCATCGTGGCTGCTTATCGTGAAATTGAACAGGCGGAGTGGAAAGCGGTTATTTATCCG
TTGCCCAAAAAACGCGTGGATCCTTGGTATAAAAAAATGTGGCCAGGGCAAGACCAACAAGATCCGATCA
TGAAGGTACGCGTTGAGCGTCTGTCAATATCAATTAAAGAAATGGATTAA