SecReT6
Protein ID: 384127018
SecReT6 ID576
T6SS typei3
Gene symbol-
Locus tagYPD8_2566
StrainYersinia pestis D182038
Repliconchromosome [GenBank: NC_017160] [Browse all T6SS(s) in this replicon]
Location [Strand]3259129..3259614 [-]
Producthypothetical protein
NoteTssD
UniProt IDD0JP07
KEGG IDypx:YPD8_2566
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.40E-43, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|384127018|ref|YP_005509632.1| hypothetical protein YPD8_2566 [Yersinia pestis D182038]
MAQDMFIKIDGIEGESLDANHKNEIQVLAWNWDVAQHSNMHSGSGGGSGKASVSDFCFAHYIDKASPNLL
SYCLLGKHIKNVQFVLRKAGGDPLEYLTIKFTDVIITRVDMAGSLEDETRPREEIRFSFTKMTQDYVMQN
AEGHKSGVISANYDVKANMHS
 
Nucleotide Sequence: 486 bp     [Download]
>gi|384124469|ref|NC_017160.1|:c3259614-3259129 Yersinia pestis D182038 chromosome, complete genome
ATGGCGCAAGATATGTTTATCAAAATTGATGGTATTGAAGGTGAGTCTTTGGATGCCAATCACAAAAACG
AAATCCAGGTATTAGCTTGGAACTGGGATGTTGCTCAACACTCGAATATGCACAGCGGTTCAGGTGGCGG
TTCAGGTAAAGCCTCTGTTTCAGATTTTTGCTTCGCACATTATATCGATAAAGCTAGCCCGAACTTATTG
AGCTATTGCTTGTTGGGTAAGCACATTAAAAATGTTCAGTTCGTACTGCGTAAAGCTGGTGGCGATCCGC
TGGAATATCTGACAATTAAATTTACCGATGTCATCATTACTCGTGTTGATATGGCGGGTTCTTTGGAAGA
TGAAACGCGTCCACGTGAAGAAATTCGTTTCTCATTCACTAAGATGACTCAGGACTATGTTATGCAGAAT
GCTGAAGGCCATAAGTCTGGCGTTATTTCTGCTAACTACGATGTTAAAGCTAACATGCACAGCTAA