SecReT6
Protein ID: 384127020
SecReT6 ID576
T6SS typei3
Gene symbol-
Locus tagYPD8_2568
StrainYersinia pestis D182038
Repliconchromosome [GenBank: NC_017160] [Browse all T6SS(s) in this replicon]
Location [Strand]3261466..3261990 [-]
Producthypothetical protein
NoteTssB
UniProt IDD0JP09
KEGG IDypx:YPD8_2568
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.40E-59, Aligned region: 11..164
Protein Sequence: 174 a.a.     [Download]
>gi|384127020|ref|YP_005509634.1| hypothetical protein YPD8_2568 [Yersinia pestis D182038]
MVSKSNSQKFIARNRAPRVQIEYDVEIYGSEKKVELPFVMGVLADLSGKPLEPLPSVADRKLLDIDIDNF
DERMKAMKPRVAFAVLNTLTGEGQLMVDITFESMDDFSPDAIAKKVDSLSQLLDARTQLANLQTYMDGKA
GAEELVMKLLKDKSLLTTLASAPKAKQSAVDTPQ
 
Nucleotide Sequence: 525 bp     [Download]
>gi|384124469|ref|NC_017160.1|:c3261990-3261466 Yersinia pestis D182038 chromosome, complete genome
ATGGTTAGCAAAAGTAATTCTCAAAAGTTTATCGCTCGAAACCGAGCGCCACGCGTGCAGATTGAATACG
ATGTGGAAATATACGGTAGTGAAAAGAAGGTTGAATTACCTTTCGTTATGGGGGTATTAGCAGATTTATC
CGGTAAACCTCTTGAGCCTTTACCTTCAGTCGCTGACAGAAAACTGTTAGATATCGATATTGATAATTTC
GATGAGCGCATGAAAGCAATGAAACCACGTGTTGCATTCGCCGTGCTGAATACATTGACTGGGGAAGGCC
AGTTAATGGTCGATATTACGTTTGAGAGTATGGATGATTTCTCTCCTGACGCTATCGCGAAAAAAGTTGA
TTCATTGTCTCAATTATTAGATGCCCGAACTCAACTTGCCAACTTGCAGACTTATATGGATGGTAAGGCT
GGTGCTGAGGAATTAGTTATGAAATTGCTGAAAGACAAATCATTACTGACAACGCTTGCATCCGCACCGA
AAGCAAAACAATCCGCTGTTGATACTCCACAGTAA