SecReT6
Protein ID: 384127028
SecReT6 ID576
T6SS typei3
Gene symbol-
Locus tagYPD8_2576
StrainYersinia pestis D182038
Repliconchromosome [GenBank: NC_017160] [Browse all T6SS(s) in this replicon]
Location [Strand]3271978..3273813 [+]
Producthypothetical protein
NoteTssF
UniProt IDD0JP17
KEGG IDypx:YPD8_2576
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.30E-195, Aligned region: 1..610
Protein Sequence: 611 a.a.     [Download]
>gi|384127028|ref|YP_005509642.1| hypothetical protein YPD8_2576 [Yersinia pestis D182038]
MREMAQEFAEKHPKIAGRLGMHGIEVADPYVERLIESFCFLSARTQIKLDAEFPKFTQRLLDIVYPNYNS
PTPSMGVIQLKPNLKEGDLTQGYCVPRGSSFFTHIAPGETTRCEFRSGQDVELWPLEIAEARLSSVPPDM
PNLEKHRIAYHRLKGALRIKLKLVGDLTFSQLEGLDRLPIYIDGDERIVSHIFELLHASHVATIIRAGHG
ETAKDTVISDQPLSFEGLSPDQSLLPLSWNIFHGHNLVQEYFTCRQRFYFFTLTQLSQSLRDNHTGEAEI
IILLDRLPQDLVSHVAPSRFLLACTPVINLFPKRMDKIEINRALNDFHVVPDRSRPLDYEVFAINKVFGQ
QAETSNEVVFNPLYQTRHCDNGNFGRYFSITRKARTGDSNKRKYDTRTPYASTEVFVSLVDQQEAPYGDS
LRYLSIEAQVTNRDLPRLISASGNFELTMSDSAPVHGARFVFQPSAPRAPFAMDESAWRLIRQLSFNYLP
LSDMSHSNGGESLRNMLRLFVNASDHESNTQIDALVGCKSEPVIRRLPGNGLLVYGRGICCTLTVDEEGF
SGISPYLFGMIMENYVARHAAINVFTETELNSMQRGRVGHWKARPGRRGVL
 
Nucleotide Sequence: 1836 bp     [Download]
>gi|384124469|ref|NC_017160.1|:3271978-3273813 Yersinia pestis D182038 chromosome, complete genome
ATGCGCGAGATGGCGCAAGAGTTTGCTGAAAAACATCCCAAAATAGCAGGCCGCCTGGGCATGCATGGGA
TTGAAGTCGCCGACCCTTACGTTGAGCGGCTGATAGAGTCCTTCTGTTTTTTATCTGCCAGAACGCAGAT
TAAGTTGGATGCTGAGTTTCCTAAATTTACTCAGCGTCTTTTGGACATTGTCTATCCCAATTACAATTCG
CCAACCCCCTCAATGGGCGTGATCCAACTTAAGCCAAATCTGAAGGAAGGAGATTTGACTCAAGGGTATT
GTGTTCCCAGGGGCAGCTCGTTCTTCACCCATATCGCACCTGGCGAGACAACCCGCTGCGAGTTCCGCAG
TGGTCAGGATGTGGAGTTGTGGCCACTGGAAATAGCAGAAGCGCGTCTAAGCTCTGTTCCCCCGGATATG
CCTAATCTGGAAAAGCACCGCATTGCCTATCATCGGCTTAAAGGTGCCTTACGCATTAAATTAAAATTAG
TGGGCGATCTCACTTTCTCACAATTAGAAGGCCTTGATCGGCTGCCTATTTATATTGATGGTGATGAACG
AATCGTTTCACATATCTTCGAGCTACTCCACGCCAGCCATGTTGCTACCATCATACGGGCAGGCCACGGA
GAGACAGCAAAAGACACCGTGATCAGTGATCAGCCACTGTCCTTTGAAGGGCTAAGCCCCGACCAAAGCC
TACTGCCGCTATCATGGAATATCTTTCACGGACATAATCTGGTGCAGGAATACTTTACCTGCCGCCAGCG
TTTCTACTTTTTTACGCTGACACAGCTGTCGCAAAGTTTGCGCGATAATCATACCGGTGAAGCGGAAATC
ATCATCCTACTGGACAGATTACCGCAGGATTTGGTGAGCCATGTTGCCCCCTCTCGCTTCCTGTTAGCCT
GCACGCCAGTGATTAATCTCTTTCCTAAACGCATGGATAAGATCGAAATTAACCGTGCACTGAACGATTT
TCACGTAGTACCAGACCGTAGCCGCCCACTGGATTATGAGGTTTTCGCCATTAATAAAGTGTTTGGTCAA
CAGGCGGAAACCAGCAACGAGGTGGTATTTAACCCACTTTATCAAACCCGTCACTGTGATAATGGCAACT
TTGGGCGTTATTTCTCCATCACCCGCAAGGCCAGAACGGGCGATAGCAACAAAAGAAAATATGACACCCG
CACGCCTTACGCCAGTACCGAGGTCTTTGTCTCGTTGGTCGATCAACAAGAGGCTCCTTATGGCGATAGC
TTGCGCTACCTCTCTATTGAAGCTCAGGTGACTAATCGGGATCTTCCGCGCCTGATTTCCGCCAGTGGTA
ATTTTGAATTGACCATGTCGGATTCAGCGCCCGTTCACGGTGCCCGGTTTGTCTTCCAACCCAGCGCCCC
ACGCGCCCCCTTTGCCATGGATGAATCCGCCTGGCGTTTGATTCGCCAATTGAGCTTCAACTATCTGCCA
CTGTCAGATATGTCCCACTCGAATGGGGGGGAGTCACTGCGCAATATGCTACGTCTGTTTGTTAACGCTT
CAGACCATGAATCGAATACACAAATTGACGCGCTGGTGGGCTGTAAAAGCGAGCCGGTGATCCGCCGGTT
ACCCGGCAATGGCCTACTGGTTTATGGCCGGGGCATCTGCTGCACTTTGACCGTGGATGAAGAAGGATTC
TCCGGTATCAGCCCTTATCTATTTGGCATGATCATGGAAAATTATGTGGCCCGCCATGCCGCAATAAATG
TGTTTACCGAGACCGAGCTAAACTCCATGCAAAGAGGACGTGTCGGTCATTGGAAAGCCCGCCCTGGCAG
ACGAGGAGTCCTGTAA