SecReT6
Protein ID: 384127689
SecReT6 ID577
T6SS typei1
Gene symbol-
Locus tagYPD8_3240
StrainYersinia pestis D182038
Repliconchromosome [GenBank: NC_017160] [Browse all T6SS(s) in this replicon]
Location [Strand]4090590..4092992 [-]
Productputative Rhs accessory genetic element
NoteTssI
UniProt IDD0JSV2
KEGG IDypx:YPD8_3240
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.40E-69, Aligned region: 194..491
Phage_GPD [PF05954], Evalue: 1.40E-69, Aligned region: 670..701
Phage_base_V [PF04717], Evalue: 1.90E-23, Aligned region: 531..623
Protein Sequence: 800 a.a.     [Download]
>gi|384127689|ref|YP_005510303.1| putative Rhs accessory genetic element [Yersinia pestis D182038]
MFAHDKANNNKAADKTGTVTPTHIVSPEAAPTVSGAQMTEMAGGIGDAVGGTAGKRINQAAEVAKTALDA
KAKVLDGGVTPTNIVATGPAPTVSGAQMTEMAGGIGDAVGGTAGKRINQAAEVAKTALEAKAKVLDGGVT
PMNLAAGGAGAGLPDSAAAAISRLVKQPSGLQFTLTTASLPPQTFAVVDFTLSEMLSSPFVLNVGLASAD
PAVDFAAVLDEDATLFIWREGVLQRSITGMVASFEQGDTGFHQTRYSMVIRPALWRTSLRRNARIFQQAS
VEEIITTLLKENGINDFAFGFRHPHPVREFCVQYQESDFDFIQRLTAEEGIFYYFEFSAGKNTVVYADDV
GSLPKGASLPYNPNVAAQAQELSITTFTRSAQVRPAMVQLKDYTFKNPNWAAAFSEQSGELQNQRPDYEH
FDFPGRFKDAQHGQDFTRYRLDALRNDANLGQGASNDFTLQPGQLFSLYNHPRGDLNHAWQLLGIQHSGK
QMQALEQASGDQGTVLFNHFSFIPHTQTWRPTPLAKPAMDGPQIAMVVGPPGEEIYCDEYGRIRLQFLWD
RYGQSNDNSSCWIRVTQPWAGQGWGMLAIPRIGQEVVVDFLHGDPDQPIVTGRTYHANNIPPGSLPASKT
QMAFRSKTHKGEGYNEMRFEDAKGGEGLFMHAQKDMTTMVLNDRKTDVTQDHSEHIGQDQSVTVVRNQSN
TIQNDRRVEVTRDQQTEVGNDYQLVVKGEKKEFVTKIRYTEVHEDETLTVTKSIKIHAKQGDISISTPNA
GITITHDGAIVLQGKYIRLAADMIDLNPEE
 
Nucleotide Sequence: 2403 bp     [Download]
>gi|384124469|ref|NC_017160.1|:c4092992-4090590 Yersinia pestis D182038 chromosome, complete genome
ATGTTTGCTCATGATAAAGCTAATAATAATAAAGCCGCGGACAAGACCGGCACGGTGACGCCGACCCATA
TCGTCTCGCCGGAGGCCGCCCCAACCGTGAGTGGCGCTCAGATGACCGAGATGGCCGGGGGGATTGGGGA
TGCGGTGGGCGGCACTGCCGGTAAGCGCATCAATCAGGCCGCCGAGGTGGCAAAAACCGCCCTGGATGCC
AAAGCAAAAGTACTGGACGGCGGCGTCACGCCGACGAACATTGTGGCCACTGGCCCGGCCCCAACCGTGA
GTGGCGCTCAAATGACCGAGATGGCCGGGGGGATCGGGGATGCGGTGGGCGGTACTGCCGGTAAGCGCAT
TAATCAGGCCGCCGAGGTGGCTAAAACCGCCCTGGAGGCCAAAGCAAAAGTACTGGACGGCGGCGTCACG
CCGATGAATCTGGCCGCGGGCGGGGCCGGTGCGGGATTGCCGGACAGCGCCGCGGCGGCGATATCCCGCC
TGGTCAAACAGCCCTCCGGCCTGCAATTTACCCTGACGACGGCCAGTTTACCGCCCCAGACCTTTGCGGT
GGTGGATTTCACCCTGAGCGAGATGCTCTCCTCGCCGTTTGTGCTCAATGTCGGGCTGGCGAGTGCCGAT
CCGGCGGTGGATTTTGCGGCGGTATTGGATGAAGACGCCACGCTGTTTATCTGGCGCGAAGGGGTACTGC
AACGCAGCATCACCGGCATGGTCGCCAGCTTTGAACAGGGCGATACCGGTTTTCATCAGACCCGCTACAG
CATGGTGATCCGCCCGGCGCTGTGGCGCACCAGCCTGCGGCGCAATGCCCGCATCTTCCAGCAAGCCTCG
GTGGAAGAGATCATCACCACCCTGCTGAAAGAGAACGGCATCAACGATTTTGCTTTTGGTTTTCGCCACC
CGCACCCGGTGCGCGAGTTCTGCGTGCAATATCAGGAGTCCGATTTTGATTTTATCCAGCGCCTGACGGC
AGAAGAGGGGATTTTCTACTACTTCGAGTTCAGCGCCGGGAAAAATACCGTGGTGTATGCCGATGATGTT
GGCTCCCTGCCGAAAGGCGCGTCACTGCCCTATAACCCGAATGTGGCGGCGCAGGCGCAGGAACTGAGTA
TCACCACCTTCACCCGCAGTGCGCAGGTGCGCCCGGCGATGGTGCAACTGAAAGACTACACCTTTAAAAA
CCCGAACTGGGCCGCGGCCTTCAGCGAACAGTCGGGAGAACTGCAAAACCAGCGACCGGACTACGAGCAT
TTTGATTTTCCGGGGCGCTTCAAAGATGCCCAGCACGGGCAGGATTTTACCCGCTACCGGCTGGACGCGC
TGCGCAATGACGCCAATCTGGGGCAGGGGGCCAGCAATGATTTTACCCTCCAGCCGGGGCAGTTGTTCAG
CCTGTACAACCACCCGCGTGGTGATCTGAACCACGCCTGGCAGTTGCTCGGTATTCAGCACAGCGGCAAA
CAGATGCAGGCGCTGGAGCAGGCATCTGGCGATCAGGGCACGGTGCTGTTCAACCACTTCAGTTTTATTC
CGCACACCCAGACCTGGCGGCCGACGCCGTTGGCTAAACCGGCGATGGACGGCCCGCAGATCGCCATGGT
GGTGGGGCCGCCGGGGGAAGAGATTTACTGCGACGAATACGGCCGCATCCGCCTGCAATTTTTATGGGAT
CGCTACGGGCAGAGCAATGACAACAGCTCCTGTTGGATCCGGGTAACCCAGCCGTGGGCGGGCCAGGGCT
GGGGCATGCTGGCCATTCCGCGTATTGGTCAGGAAGTGGTGGTGGATTTTCTGCACGGCGATCCGGATCA
ACCGATTGTCACGGGGCGGACCTATCACGCCAACAACATCCCGCCGGGGTCGTTACCGGCCAGTAAAACC
CAGATGGCGTTCCGCTCAAAAACCCACAAAGGGGAAGGCTACAACGAAATGCGCTTCGAGGATGCCAAAG
GCGGCGAAGGGCTGTTTATGCATGCGCAGAAAGATATGACGACCATGGTGCTGAATGATCGCAAAACCGA
TGTGACTCAGGACCATTCAGAGCACATTGGGCAAGATCAGTCCGTGACGGTTGTGCGTAACCAAAGTAAT
ACGATCCAAAATGATCGCCGGGTAGAGGTGACTCGCGATCAACAAACCGAAGTGGGCAATGATTACCAGC
TAGTGGTGAAAGGTGAAAAGAAAGAGTTTGTGACGAAAATTCGTTACACCGAAGTGCATGAAGACGAAAC
GCTCACGGTGACGAAAAGTATTAAAATCCATGCCAAACAAGGTGATATCAGCATATCAACCCCGAATGCC
GGAATTACGATCACCCATGACGGTGCCATTGTTCTGCAAGGGAAATACATTCGTTTAGCGGCCGATATGA
TCGATCTTAATCCAGAGGAGTAG