SecReT6
Protein ID: 384127694
SecReT6 ID577
T6SS typei1
Gene symbol-
Locus tagYPD8_3245
StrainYersinia pestis D182038
Repliconchromosome [GenBank: NC_017160] [Browse all T6SS(s) in this replicon]
Location [Strand]4098015..4099403 [-]
Producthypothetical protein
NoteTssA
UniProt IDD0JSV7
KEGG IDypx:YPD8_3245
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.30E-16, Aligned region: 53..112
DUF1020 [PF06255], Evalue: 0.01, Aligned region: 111..144
Protein Sequence: 462 a.a.     [Download]
>gi|384127694|ref|YP_005510308.1| hypothetical protein YPD8_3245 [Yersinia pestis D182038]
MDITSQHPWHVLLQAPLSPEQTAQALADDDPQWEYIDGQMVKLGSLAHATLNIDDIQQQAMALLSQKSKD
FRLVVHLLRTLQHGGQPDELMLAMSLLTEYVQLFWTTAWPQNPLHKRRFAQQILKRFDSASSSFSQRADE
AQRENVQGLLAHLAQVWHSREPGLAKEVDALRSRYARPPERVIEAVASDEPLSSNTLAAAMAATPVSPSL
AIDNTSDRAWRQTLLKMADLLSEQQPDAAIGFRLRRHAVWGALTAPPMAQSDGRTPLAAVSADRTADYLA
RLANADLPLWHQVEQSLTLAPYWLDGHVLSAQIALQLGYDAVAQAIRDELSVFLARIPALKTLFFTDMTP
FLSSESAAWLQQDANHQGRSRTIEQDEIWQCYQQQGLEAALQMINRQPQQSEPRDRFYHQLLSAQLFEKA
GLTALAQQHYHSLLLVGQQLQLSEWEPALIALLTEKQRQLKP
 
Nucleotide Sequence: 1389 bp     [Download]
>gi|384124469|ref|NC_017160.1|:c4099403-4098015 Yersinia pestis D182038 chromosome, complete genome
ATGGATATCACGTCACAACATCCCTGGCATGTCTTGTTACAAGCCCCTTTGTCACCTGAGCAGACCGCAC
AAGCCCTGGCCGATGATGACCCCCAATGGGAATATATCGACGGCCAGATGGTGAAACTGGGGTCATTGGC
CCACGCCACGCTGAATATTGATGATATTCAGCAACAAGCCATGGCGCTGTTATCACAGAAAAGTAAAGAC
TTCCGGCTCGTGGTGCATCTACTGCGCACCCTACAACACGGGGGCCAGCCAGATGAATTAATGCTGGCGA
TGTCGTTGCTGACCGAATACGTCCAGCTATTTTGGACTACGGCCTGGCCGCAAAATCCTTTACACAAACG
GCGCTTTGCTCAACAAATCCTAAAACGCTTTGACAGCGCCAGCAGCAGTTTTAGCCAACGAGCGGACGAG
GCTCAACGTGAGAATGTGCAAGGATTATTGGCACATTTAGCACAGGTTTGGCATAGCCGTGAGCCGGGTC
TGGCTAAAGAGGTGGATGCATTACGCAGCCGCTATGCGCGGCCACCGGAGCGGGTTATCGAGGCAGTGGC
TTCTGATGAACCGCTCTCATCCAACACCTTGGCGGCGGCAATGGCCGCCACCCCCGTTAGCCCAAGCCTC
GCCATAGATAACACGAGCGACAGAGCCTGGCGGCAGACCTTGCTGAAAATGGCGGATCTACTCAGCGAAC
AGCAACCCGATGCCGCTATCGGTTTCCGGCTACGCCGCCATGCCGTATGGGGCGCGTTAACCGCACCACC
TATGGCGCAGAGCGATGGCCGCACCCCGTTAGCCGCGGTATCTGCGGATCGAACCGCCGATTACTTAGCA
CGTCTGGCTAATGCCGATTTGCCTTTGTGGCACCAAGTGGAGCAGAGCCTCACCCTCGCGCCTTATTGGC
TGGATGGACATGTGCTTTCGGCACAAATCGCCCTGCAACTGGGTTATGACGCGGTGGCACAGGCTATCCG
TGATGAACTCAGCGTTTTTTTAGCCCGTATTCCCGCATTAAAAACCCTCTTTTTTACGGATATGACGCCA
TTCCTCTCCTCTGAATCTGCCGCCTGGTTACAGCAGGATGCGAATCATCAGGGAAGAAGTCGCACTATTG
AACAGGATGAAATTTGGCAATGCTATCAACAGCAAGGATTGGAAGCCGCACTACAGATGATAAACCGGCA
ACCACAGCAATCCGAACCTCGGGACCGTTTTTACCATCAATTGCTCAGTGCACAGTTGTTCGAAAAAGCA
GGGTTAACCGCATTGGCGCAGCAGCACTACCACAGCTTATTACTGGTAGGGCAGCAATTACAGCTAAGCG
AATGGGAACCTGCGTTGATCGCTCTACTGACAGAAAAACAGCGACAACTCAAACCATGA