SecReT6
Protein ID: 384127702
SecReT6 ID577
T6SS typei1
Gene symbol-
Locus tagYPD8_3253
StrainYersinia pestis D182038
Repliconchromosome [GenBank: NC_017160] [Browse all T6SS(s) in this replicon]
Location [Strand]4107603..4108691 [-]
Producthypothetical protein
NoteTssG
UniProt IDD0JSW5
KEGG IDypx:YPD8_3253
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 6.30E-93, Aligned region: 38..348
Protein Sequence: 362 a.a.     [Download]
>gi|384127702|ref|YP_005510316.1| hypothetical protein YPD8_3253 [Yersinia pestis D182038]
MAGTDRSTCTDVSVVEDVSGVENVNGVEARPEGQALDVSRYNFFQLVELLNQLAVAWQGAAPVATPANEA
IRFKSTASLAFPTRDVIALDTSARGQFELEVSFLGLHGSQSPLPGYYLDSLAWEDAQNENRLTDFMNVFN
HRLLTLLHQIWRKYRYYICFDNGGDDAFSQRMFSLVGLGSEVVRNKLQINHSKMLAYAGLLASPGRAPEV
ICSLVSHCFNLPDITLHSWQLRKVDIAPSQQNRLGTRVKVRGKKYDEKSVLGVNFSIGSRVADRSGKFLL
CINKLTREQFLSFLPNGANYASLVMFVAFIMRDQFAWDLRLGLAEQQVGGMVLGTEQNSLLGWTSILGDP
EQKPSVTIGVME
 
Nucleotide Sequence: 1089 bp     [Download]
>gi|384124469|ref|NC_017160.1|:c4108691-4107603 Yersinia pestis D182038 chromosome, complete genome
ATGGCCGGTACAGACAGGTCAACATGCACTGATGTAAGTGTGGTTGAGGATGTAAGTGGGGTTGAGAATG
TAAATGGGGTTGAGGCAAGACCCGAAGGGCAGGCATTGGATGTTTCACGTTATAACTTTTTTCAATTGGT
CGAATTGCTCAACCAATTGGCGGTAGCGTGGCAAGGTGCGGCCCCTGTGGCGACCCCAGCCAATGAAGCC
ATCCGTTTTAAATCGACCGCCAGTTTAGCATTCCCGACCAGAGATGTGATCGCACTGGACACCTCCGCCC
GAGGTCAATTTGAGTTAGAGGTCTCTTTCCTTGGATTGCATGGCAGCCAATCGCCGCTACCAGGATATTA
CCTCGATTCGTTAGCGTGGGAGGATGCGCAGAATGAGAACCGGCTAACGGATTTCATGAACGTATTCAAC
CACCGCCTGTTAACGCTACTGCATCAGATTTGGCGTAAATACCGTTACTACATCTGCTTTGACAATGGCG
GTGATGATGCATTTTCACAACGCATGTTCTCGCTGGTGGGGTTAGGTAGCGAGGTCGTCCGCAATAAATT
GCAGATCAATCACAGCAAAATGCTGGCTTATGCAGGGCTGCTGGCCAGCCCCGGCAGAGCACCTGAAGTG
ATTTGCAGCCTTGTCTCACATTGCTTCAATTTGCCAGATATCACCTTACACAGTTGGCAGCTACGCAAAG
TGGATATTGCCCCCTCACAGCAGAATCGCTTGGGGACGAGGGTGAAAGTCCGTGGCAAGAAATATGATGA
AAAATCAGTGCTTGGCGTTAATTTCTCCATCGGTTCACGGGTTGCGGATCGTAGCGGGAAATTCTTGTTG
TGCATCAATAAGCTGACGCGAGAACAGTTCTTATCCTTTTTACCCAACGGGGCTAATTACGCCTCGTTAG
TGATGTTTGTCGCCTTCATTATGCGCGATCAATTCGCGTGGGATTTACGCCTTGGGTTGGCCGAGCAACA
GGTGGGCGGGATGGTGTTGGGAACCGAGCAAAATAGCCTATTGGGCTGGACCAGTATCCTCGGCGATCCC
GAACAGAAACCCAGCGTAACGATTGGTGTAATGGAATAA