SecReT6
Protein ID: 384127703
SecReT6 ID577
T6SS typei1
Gene symbol-
Locus tagYPD8_3254
StrainYersinia pestis D182038
Repliconchromosome [GenBank: NC_017160] [Browse all T6SS(s) in this replicon]
Location [Strand]4108655..4109449 [-]
Producthypothetical protein
NoteTssF
UniProt IDD0JSW6
KEGG IDypx:YPD8_3254
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 4.70E-74, Aligned region: 19..264
Protein Sequence: 264 a.a.     [Download]
>gi|384127703|ref|YP_005510317.1| hypothetical protein YPD8_3254 [Yersinia pestis D182038]
MNRTSRSWIKRSKIWGSVHRGHGREYTSFESFHHQIEHSQEKTALYYRLRVKNSLFRKGFEHYISFVRSD
ESKLVLAEENVSVSLTCTNRELPLSLRVGDINQLSTDSPSFATFRNITRPSVPLYPVLDGGLHWSLLSNM
SLNYMSLLDKDALKQILHTYDFPSLHNRQSARASQKKLDAIQRIETQPIDRLFRGLPVRGLQTTLWLEQG
AFSSEGELYLFSTVLARFFSLYASVNAFHLLKVINLDNQECYEWPVQTGQHALM
 
Nucleotide Sequence: 795 bp     [Download]
>gi|384124469|ref|NC_017160.1|:c4109449-4108655 Yersinia pestis D182038 chromosome, complete genome
TTGAACCGAACCTCCAGATCATGGATAAAAAGATCCAAGATCTGGGGTTCAGTGCACCGGGGTCATGGCC
GGGAGTACACCTCGTTTGAGAGCTTCCACCATCAGATCGAACACTCGCAAGAAAAGACCGCACTTTATTA
CCGCCTACGTGTGAAAAATTCATTATTCCGTAAGGGATTCGAACACTACATTTCCTTTGTTCGCAGTGAT
GAATCGAAGCTGGTGCTTGCTGAAGAGAATGTCTCGGTCAGCCTGACGTGCACCAACCGTGAGTTGCCGC
TGTCGTTGCGCGTTGGTGATATCAATCAACTCAGCACAGACAGCCCTTCATTCGCGACGTTCCGCAATAT
TACCCGTCCTTCCGTGCCGTTGTATCCGGTGCTGGATGGGGGCCTGCATTGGTCATTGCTCTCCAATATG
TCGTTGAACTACATGTCCTTACTGGATAAGGACGCGTTGAAGCAAATTCTGCATACCTATGATTTCCCAA
GCCTGCATAACCGGCAATCAGCCAGGGCATCGCAAAAGAAACTGGACGCTATCCAACGTATTGAAACACA
ACCGATTGACCGGTTGTTTCGTGGCTTACCTGTCAGAGGGCTACAAACCACGCTATGGCTGGAGCAAGGC
GCTTTTAGCTCTGAAGGCGAGCTTTATCTCTTCAGCACGGTATTAGCTCGCTTCTTCTCACTGTATGCCA
GCGTCAATGCGTTTCATCTTTTAAAAGTCATCAATCTTGATAATCAGGAATGTTACGAATGGCCGGTACA
GACAGGTCAACATGCACTGATGTAA