SecReT6
Protein ID: 384127706
SecReT6 ID577
T6SS typei1
Gene symbol-
Locus tagYPD8_3257
StrainYersinia pestis D182038
Repliconchromosome [GenBank: NC_017160] [Browse all T6SS(s) in this replicon]
Location [Strand]4111919..4112317 [-]
Producthypothetical protein
NoteTssE
UniProt IDD0JSW9
KEGG IDypx:YPD8_3257
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 9.80E-20, Aligned region: 18..108
Protein Sequence: 132 a.a.     [Download]
>gi|384127706|ref|YP_005510320.1| hypothetical protein YPD8_3257 [Yersinia pestis D182038]
MFDRIQGKGASSSSDGRLRELLNSIQKHLNEVLNSRPGACQSAVDLGVIDLNDATATSSDFRKSIEKAIK
DCIENYEPRISAVTVQSLLNHGDPLQLSFHISARVNFDDMGDVVEFNIQLDNNRRYCFNQET
 
Nucleotide Sequence: 399 bp     [Download]
>gi|384124469|ref|NC_017160.1|:c4112317-4111919 Yersinia pestis D182038 chromosome, complete genome
TTGTTTGACCGCATACAGGGGAAGGGCGCTAGCTCTTCCTCCGATGGCCGTCTGCGTGAGCTATTGAATT
CAATCCAAAAGCATTTGAACGAGGTCCTTAACTCTCGTCCAGGTGCTTGCCAAAGTGCGGTCGATCTCGG
GGTTATCGACCTCAATGATGCGACCGCCACCTCATCTGATTTTCGAAAAAGTATTGAGAAAGCCATTAAG
GATTGTATCGAGAACTACGAACCCCGAATTTCTGCCGTTACAGTTCAATCCTTGCTGAACCATGGCGACC
CACTGCAACTGAGTTTCCATATTAGCGCTCGTGTTAATTTCGACGATATGGGTGATGTCGTTGAGTTCAA
CATTCAGTTAGACAATAACCGCCGTTACTGCTTTAACCAGGAAACATAA