SecReT6
Protein ID: 384127707
SecReT6 ID577
T6SS typei1
Gene symbol-
Locus tagYPD8_3258
StrainYersinia pestis D182038
Repliconchromosome [GenBank: NC_017160] [Browse all T6SS(s) in this replicon]
Location [Strand]4112366..4113847 [-]
Producthypothetical protein
NoteTssC
UniProt IDD0JSX0
KEGG IDypx:YPD8_3258
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.00E-185, Aligned region: 66..491
Protein Sequence: 493 a.a.     [Download]
>gi|384127707|ref|YP_005510321.1| hypothetical protein YPD8_3258 [Yersinia pestis D182038]
MPLHEENTVLAAEPASATFLLDEIMSQTRMAPGNDGYDIAKQGVAAFISSILDTGTNEEPINKLLVDRMI
IELDKKLSAQMDEILHANEFREIESSWRSLKLLVDRTDFRENIKINIMHATKEELLEDFEFSPEIIQSGF
YKHVYSSGYGQFGGEPTAAIIGNYAFNNSSPDMKLLQYVSAVGAMAHAPFLSSVAPDFFGISSFTELPAI
KDLKSVFEGPAHTKWRALRESEDSRYLGLTTPRFLLRLPYSTVENPIKNFNYYEDVSRNHEHFLWGNTAF
LLASCLTDSFAKYRWCPNIIGPQSGGTVHDLPVHLYEAMGQIQAKIPTEVLITDRREFELAEEGFITLTM
RKGSDNAAFFSANSVQKPKVFPNTREGKMAETNYKLGTQLPYMFVINRLAHYIKVLQREQIGSWKERQDL
ERELNIWLKQYIADQENPPTDVRSRRPLRSAQIQVLDVEGDPGWYQVAMQVRPHFKYMGASFELSLVGRL
DKE
 
Nucleotide Sequence: 1482 bp     [Download]
>gi|384124469|ref|NC_017160.1|:c4113847-4112366 Yersinia pestis D182038 chromosome, complete genome
ATGCCTTTACATGAAGAAAATACCGTTTTAGCGGCAGAACCTGCCAGTGCAACATTCTTGCTCGACGAAA
TCATGTCACAAACCCGTATGGCACCGGGAAACGATGGTTACGATATCGCTAAACAGGGTGTGGCCGCTTT
TATTAGCAGTATTCTGGATACCGGAACCAACGAAGAGCCGATTAACAAGCTGTTAGTTGACCGCATGATC
ATCGAACTCGACAAAAAGTTGAGTGCTCAGATGGACGAGATCCTACATGCTAACGAATTCCGTGAAATAG
AATCTTCATGGCGCTCATTGAAGCTGTTGGTGGATCGGACCGATTTCCGTGAAAACATCAAAATCAATAT
CATGCATGCAACGAAAGAAGAGTTGCTGGAAGATTTTGAGTTCTCGCCAGAAATTATTCAGTCAGGCTTC
TACAAACACGTTTATTCCTCAGGGTACGGCCAATTCGGTGGTGAACCCACTGCCGCGATCATTGGTAACT
ACGCGTTCAACAATAGCTCACCTGACATGAAGCTCTTGCAATACGTAAGTGCTGTTGGCGCGATGGCACA
TGCCCCCTTCTTATCCAGTGTGGCCCCTGATTTCTTTGGCATCAGCAGCTTCACTGAGTTACCCGCGATT
AAAGATCTGAAATCTGTATTTGAAGGGCCGGCTCACACCAAATGGCGTGCTCTGCGTGAGTCTGAAGATT
CACGTTATCTTGGTTTGACCACTCCTCGTTTCCTGTTGCGCTTACCTTACTCGACCGTTGAAAACCCCAT
TAAAAACTTCAACTACTACGAGGATGTCAGCCGGAATCACGAGCATTTCTTGTGGGGCAACACCGCATTC
CTGCTAGCGTCCTGCCTGACCGACAGCTTCGCCAAGTACCGTTGGTGCCCGAATATTATTGGGCCGCAAA
GTGGCGGCACGGTTCACGATCTCCCGGTTCATCTCTATGAAGCGATGGGGCAGATTCAGGCCAAAATCCC
AACCGAAGTTCTGATCACTGACCGTCGTGAGTTTGAACTGGCGGAAGAGGGCTTTATCACCCTGACCATG
CGTAAAGGCAGTGATAACGCCGCATTCTTCTCGGCGAATTCGGTGCAAAAACCAAAAGTCTTCCCGAATA
CCCGCGAAGGGAAAATGGCAGAAACCAACTACAAGTTGGGCACGCAACTGCCGTACATGTTTGTCATCAA
CCGCCTTGCGCACTACATCAAAGTGCTCCAGCGCGAGCAGATTGGTTCATGGAAAGAACGACAGGATCTG
GAGCGCGAGCTCAATATCTGGCTCAAGCAGTACATTGCCGATCAAGAAAACCCACCAACGGATGTTCGTA
GCCGTCGTCCTCTGCGTTCAGCGCAAATCCAGGTACTGGATGTTGAAGGTGATCCGGGCTGGTACCAGGT
TGCGATGCAGGTTCGCCCGCATTTCAAATACATGGGGGCGAGCTTCGAGCTGTCACTGGTTGGCCGTTTG
GATAAGGAATAA