SecReT6
Protein ID: 384127708
SecReT6 ID577
T6SS typei1
Gene symbol-
Locus tagYPD8_3259
StrainYersinia pestis D182038
Repliconchromosome [GenBank: NC_017160] [Browse all T6SS(s) in this replicon]
Location [Strand]4113915..4114412 [-]
Producthypothetical protein
NoteTssB
UniProt IDD0JSX1
KEGG IDypx:YPD8_3259
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.60E-57, Aligned region: 7..160
Protein Sequence: 165 a.a.     [Download]
>gi|384127708|ref|YP_005510322.1| hypothetical protein YPD8_3259 [Yersinia pestis D182038]
MSKNKQSSVAPKERINIKYVPNTGDQVAEIELPLNLLVVGDLKGVREETSIEERQVVSVNKNNFNSVMNE
ANISLSFNVPNRLEGDGEEDMPVALSIKGLDDFSPDNVAKKVPELKKILELREALVALKGPLGNIPAFRS
RLQDLLGNEDMREQLLKELDILNQK
 
Nucleotide Sequence: 498 bp     [Download]
>gi|384124469|ref|NC_017160.1|:c4114412-4113915 Yersinia pestis D182038 chromosome, complete genome
ATGAGTAAAAATAAGCAAAGCAGTGTTGCCCCAAAAGAAAGGATTAACATCAAGTATGTGCCGAATACTG
GCGACCAGGTTGCAGAAATTGAATTACCGCTGAATCTGCTGGTTGTGGGTGATCTTAAAGGCGTGCGTGA
AGAGACTTCAATTGAAGAGCGTCAGGTTGTTTCGGTCAATAAGAATAACTTCAACTCAGTCATGAACGAA
GCAAATATCAGTCTGAGTTTCAATGTGCCTAATCGCCTTGAAGGTGATGGGGAAGAAGACATGCCGGTCG
CCTTGTCGATCAAGGGTCTTGATGATTTCTCGCCTGACAATGTGGCGAAAAAAGTTCCAGAGCTCAAAAA
AATTCTGGAACTACGGGAAGCGTTAGTGGCATTGAAAGGGCCATTGGGGAATATCCCAGCTTTCCGCTCT
CGTCTACAGGATTTGCTTGGCAATGAAGATATGCGCGAGCAGTTGCTGAAAGAATTGGACATTCTTAATC
AAAAATAA