SecReT6
Protein ID: 384131707
SecReT6 ID578
T6SS typei4b
Gene symbol-
Locus tagABK1_1747
StrainAcinetobacter baumannii 1656-2
Repliconchromosome [GenBank: NC_017162] [Browse all T6SS(s) in this replicon]
Location [Strand]1853337..1854290 [+]
Producthypothetical protein
NoteTssG
UniProt IDE8PB10
KEGG IDabx:ABK1_1747
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.50E-63, Aligned region: 3..297
Protein Sequence: 317 a.a.     [Download]
>gi|384131707|ref|YP_005514319.1| hypothetical protein [Acinetobacter baumannii 1656-2]
MFQRPKSFEFIQATRLLRHMPANDAALSWSDHFKFETSFNLNFPATEIESLELVDERVHLTNLIVGLTGI
QGALPYTYTNKIKQAPRQQRAETKEFLSLFNHKLTSQYVESSITYHLPVRYEIENKNDYLDILHALNGYV
RSQHQQQDLDEYFAEFSGLMQGQNNTVHALKTMLSCIFKHEITIKEFVQESFKLAGDQLTTLGGSQPSLL
GINTFCGETIQQIDGKIEIQIGPLKRQQYLKFLPHQELSLKLKKIVETWCSPTLSIDLRLILDETEIQPV
RLTQGQESGLGQGAFLMSRKPNTHNDETCYSLIGEQI
 
Nucleotide Sequence: 954 bp     [Download]
>gi|384129960|ref|NC_017162.1|:1853337-1854290 Acinetobacter baumannii 1656-2 chromosome, complete genome
TTGTTTCAACGCCCTAAGTCTTTTGAGTTTATTCAAGCAACACGTTTATTGCGTCATATGCCTGCCAATG
ACGCAGCTTTATCATGGTCTGACCATTTTAAATTTGAGACCTCATTTAACTTAAACTTTCCAGCCACTGA
AATTGAAAGTTTAGAGTTAGTAGATGAACGTGTTCATTTAACAAACCTGATCGTTGGTCTGACTGGTATA
CAAGGTGCATTACCTTATACATATACAAATAAAATTAAGCAGGCTCCAAGGCAACAACGCGCTGAAACGA
AAGAGTTTTTAAGCTTATTTAATCATAAGCTGACCAGTCAGTATGTAGAGTCAAGTATTACTTATCACTT
GCCTGTGCGCTATGAAATTGAAAATAAAAATGATTATTTGGATATTCTCCATGCATTGAATGGTTATGTT
CGCTCACAACATCAGCAACAAGACTTGGATGAATATTTCGCTGAATTTTCAGGCCTAATGCAGGGGCAAA
ATAATACGGTTCATGCTTTAAAGACGATGTTGAGTTGTATTTTTAAGCATGAAATTACAATTAAAGAGTT
TGTACAGGAATCGTTTAAGTTAGCGGGTGATCAGCTAACCACTTTAGGCGGAAGTCAACCGAGCTTACTT
GGTATTAACACATTTTGTGGGGAAACGATTCAACAAATTGATGGAAAAATTGAGATTCAAATAGGTCCGC
TTAAGCGTCAGCAATATTTAAAATTTTTACCTCATCAAGAGCTTAGCTTAAAGCTCAAAAAAATCGTAGA
AACCTGGTGCAGTCCAACTTTATCGATAGATTTAAGATTGATATTGGATGAGACTGAAATACAACCTGTT
CGCTTAACTCAAGGCCAAGAAAGTGGTTTAGGGCAAGGCGCTTTTTTAATGTCTCGTAAGCCTAATACAC
ATAACGATGAAACATGTTATAGCCTTATTGGAGAGCAAATATGA