SecReT6
Protein ID: 384131714
SecReT6 ID578
T6SS typei4b
Gene symbol-
Locus tagABK1_1754
StrainAcinetobacter baumannii 1656-2
Repliconchromosome [GenBank: NC_017162] [Browse all T6SS(s) in this replicon]
Location [Strand]1862370..1862633 [+]
Producthypothetical protein
NotePAAR
UniProt IDE8PB17
KEGG IDabx:ABK1_1754
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 1.10E-21, Aligned region: 7..79
Protein Sequence: 87 a.a.     [Download]
>gi|384131714|ref|YP_005514326.1| hypothetical protein [Acinetobacter baumannii 1656-2]
MASPYITIGCPTTGGGQVISGNSAFLIEGIAIACVGDKATCPAHKTVSTIVSGDPNMQVMGKAAARVNDS
LSCGCKLLPKQSLVNQG
 
Nucleotide Sequence: 264 bp     [Download]
>gi|384129960|ref|NC_017162.1|:1862370-1862633 Acinetobacter baumannii 1656-2 chromosome, complete genome
ATGGCTAGCCCTTACATTACGATTGGATGCCCAACGACAGGTGGAGGGCAAGTCATTTCTGGTAATAGTG
CATTTTTAATTGAGGGAATCGCAATTGCATGTGTAGGTGATAAAGCAACTTGTCCGGCGCATAAAACGGT
TTCTACGATTGTTTCCGGTGACCCAAATATGCAAGTGATGGGAAAAGCAGCAGCAAGAGTAAATGATTCA
TTATCGTGTGGCTGTAAATTATTACCGAAACAAAGTTTGGTTAATCAAGGGTAG