SecReT6
Protein ID: 384131716
SecReT6 ID578
T6SS typei4b
Gene symbol-
Locus tagABK1_1756
StrainAcinetobacter baumannii 1656-2
Repliconchromosome [GenBank: NC_017162] [Browse all T6SS(s) in this replicon]
Location [Strand]1865558..1866652 [+]
Producthypothetical protein
NoteTssA
UniProt IDE8PB19
KEGG IDabx:ABK1_1756
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.90E-20, Aligned region: 55..114
Protein Sequence: 364 a.a.     [Download]
>gi|384131716|ref|YP_005514328.1| hypothetical protein [Acinetobacter baumannii 1656-2]
MSIDISELLKPINDSLLCGEDYSFSNEFHEIKKARTQDDLLLDQGDWVAERKQADWDFVAKSVSTLLIEK
TKDIRLLTWVIEAWTHLNGFEGMVKGITLTHTMLNQYWQDIHPIIEDDDLDQRIGLLQGLINQLPMLLKK
VPLTNTAPYYNLLDYDNFLYHENIRRKQTEEYESQSGPSELEQFDQAIFNTSKTFQYSNYQEFNSVLTEW
NVLKQTLDHLMGLDSPSFAAIDSAFETIHSTLRKIYKAEAFGTGLAPSQEQAAVITTPSMENQVPVQIVS
DQPMFQPQAQTHLANREQAMKVLQEIADYFQANEPHSPVSYMLQKTIKWSQMPLHEWLAQVIKDEHPLQM
VQEMLGVQPKNEYE
 
Nucleotide Sequence: 1095 bp     [Download]
>gi|384129960|ref|NC_017162.1|:1865558-1866652 Acinetobacter baumannii 1656-2 chromosome, complete genome
ATGAGTATTGATATTTCTGAACTACTTAAACCCATTAATGACAGCTTGCTTTGTGGTGAGGATTATTCAT
TTTCTAATGAATTTCACGAGATAAAGAAAGCCAGAACACAGGATGATCTATTATTAGATCAGGGGGATTG
GGTTGCTGAACGGAAGCAGGCAGATTGGGACTTTGTTGCGAAGAGTGTAAGCACTTTGCTCATTGAAAAA
ACCAAAGATATCCGTCTATTAACTTGGGTAATAGAAGCCTGGACTCATCTAAATGGTTTTGAAGGCATGG
TAAAGGGAATCACTTTAACTCATACCATGCTGAACCAATATTGGCAGGATATTCATCCGATTATTGAAGA
TGATGATTTGGATCAGCGTATTGGTTTATTACAAGGTCTTATTAATCAGTTGCCAATGCTGTTGAAGAAA
GTACCTTTAACCAATACAGCTCCTTATTATAACTTGCTTGATTACGATAATTTTCTATATCACGAAAATA
TACGCCGTAAGCAAACAGAAGAGTACGAGAGTCAGTCAGGTCCATCTGAATTAGAACAATTTGATCAAGC
GATCTTTAATACCTCTAAAACCTTTCAATACTCAAATTATCAAGAGTTTAATTCGGTTTTAACGGAGTGG
AATGTTTTAAAACAGACACTCGACCATTTAATGGGATTAGATTCACCGAGTTTTGCTGCAATTGATTCTG
CATTTGAAACAATACACAGCACTTTACGTAAAATTTACAAAGCAGAGGCTTTTGGTACTGGGCTTGCGCC
GAGCCAAGAACAGGCCGCTGTCATCACGACACCGTCTATGGAAAATCAAGTGCCTGTACAAATCGTATCA
GACCAGCCTATGTTTCAGCCACAAGCACAAACTCACTTGGCCAATCGCGAGCAAGCAATGAAAGTGCTGC
AAGAAATAGCTGATTATTTTCAAGCAAATGAGCCACATAGTCCTGTGAGCTATATGCTCCAAAAGACCAT
TAAATGGAGCCAAATGCCGCTGCATGAATGGTTAGCACAAGTGATTAAAGATGAGCATCCATTGCAAATG
GTTCAGGAAATGTTAGGTGTTCAACCTAAAAATGAATATGAATAA