SecReT6
Protein ID: 384137500
SecReT6 ID580
T6SS typei3
Gene symbol-
Locus tagA1122_02515
StrainYersinia pestis A1122
Repliconchromosome [GenBank: NC_017168] [Browse all T6SS(s) in this replicon]
Location [Strand]554124..554615 [-]
Productputative lipoprotein
NoteTssJ
UniProt IDG0JDG8
KEGG IDypt:A1122_02515
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.40E-17, Aligned region: 16..155
Protein Sequence: 163 a.a.     [Download]
>gi|384137500|ref|YP_005520202.1| putative lipoprotein [Yersinia pestis A1122]
MRSLFRVLPIFILTGCVLLSGCSWFSSSSEAALQKRRIDLQVVAAPLINPGPNGQAQPLKVCIIELNKEG
WSPPGLYQGTLCSGISVGGEVVSVTEYILAPTEVRQYSRDVPFEQERWWAIAAEFQEMSNGKSLLTLKSD
ARADFNRVVLVDGKALSLKASTK
 
Nucleotide Sequence: 492 bp     [Download]
>gi|384137007|ref|NC_017168.1|:c554615-554124 Yersinia pestis A1122 chromosome, complete genome
ATGCGTAGCCTCTTTCGTGTGTTGCCTATTTTTATCCTGACAGGTTGCGTCCTGCTCAGCGGCTGTAGCT
GGTTTTCCTCATCCTCAGAAGCGGCGCTACAGAAACGGCGGATTGACTTGCAGGTTGTTGCGGCTCCTCT
CATCAATCCTGGGCCCAACGGTCAGGCACAGCCCTTGAAGGTATGCATTATTGAGCTGAATAAAGAGGGG
TGGTCACCCCCCGGTTTGTATCAGGGGACGCTCTGCAGTGGCATCAGTGTAGGAGGTGAAGTCGTCAGCG
TGACGGAATACATCCTTGCGCCGACAGAGGTGCGTCAATATTCCCGCGATGTTCCCTTTGAACAAGAGCG
CTGGTGGGCAATAGCGGCTGAGTTTCAGGAGATGAGTAACGGTAAAAGCCTATTAACGCTGAAATCTGAT
GCCCGTGCGGACTTCAACCGTGTGGTGCTCGTTGATGGTAAGGCCCTGTCATTAAAAGCGTCAACAAAGT
AG