SecReT6
Protein ID: 384137505
SecReT6 ID580
T6SS typei3
Gene symbol-
Locus tagA1122_02550
StrainYersinia pestis A1122
Repliconchromosome [GenBank: NC_017168] [Browse all T6SS(s) in this replicon]
Location [Strand]558950..561298 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDG0JDH3
KEGG IDypt:A1122_02550
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.40E-64, Aligned region: 25..328
Phage_GPD [PF05954], Evalue: 3.40E-64, Aligned region: 535..589
Phage_GPD [PF05954], Evalue: 3.40E-64, Aligned region: 637..669
Phage_base_V [PF04717], Evalue: 2.30E-23, Aligned region: 365..457
Protein Sequence: 782 a.a.     [Download]
>gi|384137505|ref|YP_005520207.1| Rhs element Vgr protein [Yersinia pestis A1122]
MQLIEIENEVLSGQDAFPLSFKTQEKVSGNPSYQLVFQVAEADLDLVSLLGEIIKVRIELPDSAGYRTFF
TYVIAGADEGQRQDKFVYSLELSTWTWFLMQNRNCRIFQDLNIIDIIEQVFSKYNFADYRFDIVGNYRLR
EYCVQFAETDFDFVNRLMEDEGVWYYFEHNEDKHTLVMTDQQQFPVLEGHYAELSFLPDSEEMRAIREGI
QRIQRSQRIHSSEIVLRDFDFLNPRNTLQTHIEESRQHLQGVPLEWYDYAAGYTDPQHGESIARLRLEAI
QSNGQLLSGESNATGLVPGRSFALVQHPDNNRNRGFKLISCDYSFVQDGPDSASQGRNVACKFKALNDDV
VYRPQCVTPPPKVPGVQSATVVGARESEVHTDKFARIRVHFHWDRYKTTEDDSSCWIRVVQAWAGKGWGV
LAMPRVGQEVLVNYVDGDLDRPMVTGIVYNGENPPPYRLPDHINYSGFVSRSLRFGQPQHASQLTFDDNR
GNERIMLHAERDLQRTVERNSATAVGQDKYDTVERTATEWINNHISYKDFSFSVTGMSVSATGISVSTTG
TSLSVTGMSTSVTGVSVGFTLIGTSFTGVSTSFTGVGTSFTGASNSLTGVSNSMTGCSSSFTGTSNSMTG
SSHSMTGMSTSITGHSMSQTGSSSSITGDSTSFTGSSVSSTGSSVSTTGVSTSTTGSSTSTTGCSVSTTG
SSTSTTGNSVSMTGNSTSTTGCSISTTGSSIGTVGSSISTTGSSVSTTGSSISTTGLSVSYTGAQYSDVG
VDLKTVGMQSKN
 
Nucleotide Sequence: 2349 bp     [Download]
>gi|384137007|ref|NC_017168.1|:c561298-558950 Yersinia pestis A1122 chromosome, complete genome
ATGCAATTAATTGAGATAGAGAATGAGGTTTTATCGGGCCAGGATGCTTTTCCTCTCTCCTTCAAGACGC
AGGAAAAAGTGTCAGGGAATCCATCCTACCAACTGGTATTTCAGGTAGCAGAAGCGGATCTCGATCTGGT
CAGTTTGCTGGGGGAAATCATCAAAGTCAGGATTGAGTTACCTGACTCAGCCGGCTACCGGACCTTTTTT
ACCTATGTGATCGCCGGTGCTGATGAAGGGCAACGGCAAGACAAATTTGTTTACAGCCTGGAACTGAGTA
CCTGGACGTGGTTTTTGATGCAAAACCGCAACTGCCGGATATTTCAGGACCTGAATATTATCGATATTAT
CGAACAGGTATTCTCCAAATATAACTTTGCGGATTACCGTTTTGATATCGTCGGTAACTATCGATTACGC
GAGTACTGCGTACAGTTTGCAGAAACCGATTTCGACTTTGTTAATCGTCTGATGGAAGACGAAGGCGTTT
GGTATTACTTCGAACATAACGAAGATAAGCACACGCTGGTCATGACAGATCAGCAACAATTCCCTGTATT
GGAAGGGCATTATGCAGAACTGAGTTTCCTGCCTGACAGTGAAGAGATGCGCGCCATCCGTGAGGGGATA
CAGCGTATTCAACGCTCACAACGCATCCACTCCAGCGAAATTGTCTTACGTGACTTCGATTTCCTTAATC
CACGCAATACATTACAAACCCATATCGAAGAAAGCCGCCAACACCTGCAAGGCGTGCCACTGGAATGGTA
TGACTACGCGGCGGGTTACACCGATCCCCAGCATGGTGAGAGCATCGCCCGTTTACGCCTTGAAGCTATA
CAGAGTAATGGGCAGCTCTTGTCTGGTGAAAGTAATGCCACAGGATTAGTGCCAGGGCGCTCTTTTGCTC
TGGTACAGCACCCTGATAACAACCGTAATCGGGGATTCAAACTGATCAGTTGTGACTACAGTTTTGTCCA
GGATGGGCCGGACAGTGCGAGCCAGGGACGTAATGTCGCCTGTAAGTTTAAGGCATTGAATGATGACGTC
GTTTATCGTCCACAATGTGTCACGCCACCGCCAAAGGTCCCTGGTGTGCAAAGTGCCACAGTGGTCGGTG
CGCGTGAATCAGAAGTGCATACCGATAAGTTCGCCCGTATTCGCGTTCACTTTCACTGGGATCGTTATAA
AACCACCGAAGATGATAGCTCCTGCTGGATCCGCGTTGTACAGGCGTGGGCCGGTAAAGGCTGGGGCGTC
CTGGCGATGCCTCGGGTCGGGCAAGAAGTGCTGGTCAATTACGTTGACGGCGACCTTGATCGCCCGATGG
TGACCGGGATCGTCTACAACGGTGAGAACCCACCGCCTTACCGTTTACCTGACCACATTAACTACTCCGG
TTTTGTCTCACGCTCACTGCGCTTTGGTCAGCCACAACACGCCAGCCAGCTTACCTTCGATGATAATCGG
GGCAATGAGCGGATCATGCTACATGCTGAGCGCGACTTACAAAGAACGGTTGAACGTAACAGTGCGACGG
CCGTCGGTCAGGATAAATACGACACGGTGGAACGGACGGCCACGGAGTGGATCAACAACCATATCTCCTA
CAAAGACTTCAGTTTCTCGGTGACGGGCATGAGTGTCTCCGCGACGGGCATCAGTGTCTCGACAACGGGA
ACGAGCTTATCTGTCACCGGCATGAGCACCAGCGTCACGGGTGTCAGTGTGGGTTTCACCTTGATAGGGA
CCTCCTTTACGGGGGTGAGCACATCGTTTACCGGTGTCGGTACCTCCTTCACCGGGGCCAGCAACTCGCT
AACCGGTGTCAGCAACTCGATGACCGGGTGTAGTTCCTCCTTTACCGGTACTAGCAATAGCATGACAGGC
AGTAGCCATAGCATGACCGGCATGAGCACCAGCATCACCGGGCATAGCATGAGTCAGACGGGTTCCAGTA
GCAGCATCACCGGTGACAGTACCTCCTTTACCGGCAGCAGCGTCAGCAGTACGGGCAGCAGCGTCAGTAC
GACCGGTGTCAGTACCAGCACTACGGGGAGTAGCACCTCGACTACCGGTTGTAGCGTCAGTACTACGGGT
AGCAGCACCTCGACTACCGGTAATTCAGTCAGCATGACCGGTAACAGCACCAGTACCACGGGATGCAGTA
TTTCCACGACGGGCAGCAGTATTGGGACGGTAGGAAGCAGTATCAGCACCACGGGCAGTAGCGTCAGTAC
CACCGGTAGCAGTATCAGCACCACGGGATTATCCGTCAGTTATACCGGCGCTCAATATTCCGATGTGGGT
GTCGATCTGAAAACCGTTGGCATGCAAAGCAAAAACTGA