SecReT6
Protein ID: 384137510
SecReT6 ID580
T6SS typei3
Gene symbol-
Locus tagA1122_02575
StrainYersinia pestis A1122
Repliconchromosome [GenBank: NC_017168] [Browse all T6SS(s) in this replicon]
Location [Strand]567378..567896 [-]
Producthypothetical protein
NoteTssD
UniProt IDG0JDH8
KEGG IDypt:A1122_02575
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.60E-33, Aligned region: 8..148
Protein Sequence: 172 a.a.     [Download]
>gi|384137510|ref|YP_005520212.1| hypothetical protein A1122_02575 [Yersinia pestis A1122]
MAALVDYFLHIEGVDGESPDQQYNGWIQVQAWQWAEENAGRWGLGGGGGSGKVEMKDFEFRMVSNKASPK
LFLMCAIGEHIPQAKLVCRKSGQGQQDFLIVTFSNCLVSSFKTVGNMPLGKGDAVFTDTVLPTDAISLNF
ARIEVEYKEQQPDGSMGAVIKAGYDLKLNSRI
 
Nucleotide Sequence: 519 bp     [Download]
>gi|384137007|ref|NC_017168.1|:c567896-567378 Yersinia pestis A1122 chromosome, complete genome
ATGGCAGCTTTAGTCGATTACTTTCTCCATATCGAAGGTGTAGATGGTGAGTCTCCCGATCAGCAGTATA
ACGGATGGATCCAAGTACAGGCTTGGCAATGGGCGGAGGAGAATGCGGGGCGCTGGGGGCTAGGTGGCGG
TGGTGGTTCTGGGAAAGTCGAAATGAAGGACTTCGAATTTCGCATGGTGAGTAACAAAGCATCACCAAAA
CTATTTTTGATGTGTGCCATCGGTGAACACATTCCGCAGGCCAAGTTGGTGTGTCGTAAATCAGGTCAAG
GTCAACAAGACTTCCTGATTGTTACCTTCAGTAACTGTCTGGTGTCCTCCTTTAAAACTGTCGGCAACAT
GCCTCTTGGTAAAGGGGACGCAGTATTCACCGACACGGTGCTGCCAACGGATGCCATCAGCCTTAACTTT
GCACGTATCGAAGTGGAATACAAAGAGCAGCAACCTGATGGCTCGATGGGGGCCGTGATTAAGGCTGGTT
ACGATCTGAAATTGAACAGCCGTATTTAA