SecReT6
Protein ID: 384138441
SecReT6 ID581
T6SS typei1
Gene symbol-
Locus tagA1122_07340
StrainYersinia pestis A1122
Repliconchromosome [GenBank: NC_017168] [Browse all T6SS(s) in this replicon]
Location [Strand]1620694..1622175 [+]
Producthypothetical protein
NoteTssC
UniProt IDG0JDX7
KEGG IDypt:A1122_07340
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.00E-185, Aligned region: 66..491
Protein Sequence: 493 a.a.     [Download]
>gi|384138441|ref|YP_005521143.1| hypothetical protein A1122_07340 [Yersinia pestis A1122]
MPLHEENTVLAAEPASATFLLDEIMSQTRMAPGNDGYDIAKQGVAAFISSILDTGTNEEPINKLLVDRMI
IELDKKLSAQMDEILHANEFREIESSWRSLKLLVDRTDFRENIKINIMHATKEELLEDFEFSPEIIQSGF
YKHVYSSGYGQFGGEPTAAIIGNYAFNNSSPDMKLLQYVSAVGAMAHAPFLSSVAPDFFGISSFTELPAI
KDLKSVFEGPAHTKWRALRESEDSRYLGLTTPRFLLRLPYSTVENPIKNFNYYEDVSRNHEHFLWGNTAF
LLASCLTDSFAKYRWCPNIIGPQSGGTVHDLPVHLYEAMGQIQAKIPTEVLITDRREFELAEEGFITLTM
RKGSDNAAFFSANSVQKPKVFPNTREGKMAETNYKLGTQLPYMFVINRLAHYIKVLQREQIGSWKERQDL
ERELNIWLKQYIADQENPPTDVRSRRPLRSAQIQVLDVEGDPGWYQVAMQVRPHFKYMGASFELSLVGRL
DKE
 
Nucleotide Sequence: 1482 bp     [Download]
>gi|384137007|ref|NC_017168.1|:1620694-1622175 Yersinia pestis A1122 chromosome, complete genome
ATGCCTTTACATGAAGAAAATACCGTTTTAGCGGCAGAACCTGCCAGTGCAACATTCTTGCTCGACGAAA
TCATGTCACAAACCCGTATGGCACCGGGAAACGATGGTTACGATATCGCTAAACAGGGTGTGGCCGCTTT
TATTAGCAGTATTCTGGATACCGGAACCAACGAAGAGCCGATTAACAAGCTGTTAGTTGACCGCATGATC
ATCGAACTCGACAAAAAGTTGAGTGCTCAGATGGACGAGATCCTACATGCTAACGAATTCCGTGAAATAG
AATCTTCATGGCGCTCATTGAAGCTGTTGGTGGATCGGACCGATTTCCGTGAAAACATCAAAATCAATAT
CATGCATGCAACGAAAGAAGAGTTGCTGGAAGATTTTGAGTTCTCGCCAGAAATTATTCAGTCAGGCTTC
TACAAACACGTTTATTCCTCAGGGTACGGCCAATTCGGTGGTGAACCCACTGCCGCGATCATTGGTAACT
ACGCGTTCAACAATAGCTCACCTGACATGAAGCTCTTGCAATACGTAAGTGCTGTTGGCGCGATGGCACA
TGCCCCCTTCTTATCCAGTGTGGCCCCTGATTTCTTTGGCATCAGCAGCTTCACTGAGTTACCCGCGATT
AAAGATCTGAAATCTGTATTTGAAGGGCCGGCTCACACCAAATGGCGTGCTCTGCGTGAGTCTGAAGATT
CACGTTATCTTGGTTTGACCACTCCTCGTTTCCTGTTGCGCTTACCTTACTCGACCGTTGAAAACCCCAT
TAAAAACTTCAACTACTACGAGGATGTCAGCCGGAATCACGAGCATTTCTTGTGGGGCAACACCGCATTC
CTGCTAGCGTCCTGCCTGACCGACAGCTTCGCCAAGTACCGTTGGTGCCCGAATATTATTGGGCCGCAAA
GTGGCGGCACGGTTCACGATCTCCCGGTTCATCTCTATGAAGCGATGGGGCAGATTCAGGCCAAAATCCC
AACCGAAGTTCTGATCACTGACCGTCGTGAGTTTGAACTGGCGGAAGAGGGCTTTATCACCCTGACCATG
CGTAAAGGCAGTGATAACGCCGCATTCTTCTCGGCGAATTCGGTGCAAAAACCAAAAGTCTTCCCGAATA
CCCGCGAAGGGAAAATGGCAGAAACCAACTACAAGTTGGGCACGCAACTGCCGTACATGTTTGTCATCAA
CCGCCTTGCGCACTACATCAAAGTGCTCCAGCGCGAGCAGATTGGTTCATGGAAAGAACGACAGGATCTG
GAGCGCGAGCTCAATATCTGGCTCAAGCAGTACATTGCCGATCAAGAAAACCCACCAACGGATGTTCGTA
GCCGTCGTCCTCTGCGTTCAGCGCAAATCCAGGTACTGGATGTTGAAGGTGATCCGGGCTGGTACCAGGT
TGCGATGCAGGTTCGCCCGCATTTCAAATACATGGGGGCGAGCTTCGAGCTGTCACTGGTTGGCCGTTTG
GATAAGGAATAA