SecReT6
Protein ID: 384138446
SecReT6 ID581
T6SS typei1
Gene symbol-
Locus tagA1122_07365
StrainYersinia pestis A1122
Repliconchromosome [GenBank: NC_017168] [Browse all T6SS(s) in this replicon]
Location [Strand]1625143..1625886 [+]
Producthypothetical protein
NoteTssF
UniProt IDG0JDY2
KEGG IDypt:A1122_07365
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.00E-73, Aligned region: 4..247
Protein Sequence: 247 a.a.     [Download]
>gi|384138446|ref|YP_005521148.1| hypothetical protein A1122_07365 [Yersinia pestis A1122]
MHRGHGREYTSFESFHHQIEHSQEKTALYYRLRVKNSLFRKGFEHYISFVRSDESKLVLAEENVSVSLTC
TNRELPLSLRVGDINQLSTDSPSFATFRNITRPSVPLYPVLDGGLHWSLLSNMSLNYMSLLDKDALKQIL
HTYDFPSLHNRQSARASQKKLDAIQRIETQPIDRLFRGLPVRGLQTTLWLEQGAFSSEGELYLFSTVLAR
FFSLYASVNAFHLLKVINLDNQECYEWPVQTGQHALM
 
Nucleotide Sequence: 744 bp     [Download]
>gi|384137007|ref|NC_017168.1|:1625143-1625886 Yersinia pestis A1122 chromosome, complete genome
GTGCACCGGGGTCATGGCCGGGAGTACACCTCGTTTGAGAGCTTCCACCATCAGATCGAACACTCGCAAG
AAAAGACCGCACTTTATTACCGCCTACGTGTGAAAAATTCATTATTCCGTAAGGGATTCGAACACTACAT
TTCCTTTGTTCGCAGTGATGAATCGAAGCTGGTGCTTGCTGAAGAGAATGTCTCGGTCAGCCTGACGTGC
ACCAACCGTGAGTTGCCGCTGTCGTTGCGCGTTGGTGATATCAATCAACTCAGCACAGACAGCCCTTCAT
TCGCGACGTTCCGCAATATTACCCGTCCTTCCGTGCCGTTGTATCCGGTGCTGGATGGGGGCCTGCATTG
GTCATTGCTCTCCAATATGTCGTTGAACTACATGTCCTTACTGGATAAGGACGCGTTGAAGCAAATTCTG
CATACCTATGATTTCCCAAGCCTGCATAACCGGCAATCAGCCAGGGCATCGCAAAAGAAACTGGACGCTA
TCCAACGTATTGAAACACAACCGATTGACCGGTTGTTTCGTGGCTTACCTGTCAGAGGGCTACAAACCAC
GCTATGGCTGGAGCAAGGCGCTTTTAGCTCTGAAGGCGAGCTTTATCTCTTCAGCACGGTATTAGCTCGC
TTCTTCTCACTGTATGCCAGCGTCAATGCGTTTCATCTTTTAAAAGTCATCAATCTTGATAATCAGGAAT
GTTACGAATGGCCGGTACAGACAGGTCAACATGCACTGATGTAA