SecReT6
Protein ID: 384138450
SecReT6 ID581
T6SS typei1
Gene symbol-
Locus tagA1122_07385
StrainYersinia pestis A1122
Repliconchromosome [GenBank: NC_017168] [Browse all T6SS(s) in this replicon]
Location [Strand]1628928..1630274 [+]
Producthypothetical protein
NoteTssK
UniProt IDG0JDY6
KEGG IDypt:A1122_07385
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.40E-155, Aligned region: 19..446
Protein Sequence: 448 a.a.     [Download]
>gi|384138450|ref|YP_005521152.1| hypothetical protein A1122_07385 [Yersinia pestis A1122]
MPTKNRVIWREGLFIKPQHFQQQQRHNDYQLQRRIIALQGYSYGFSSLILNQELLKLGRIGLTVASGNMA
DGTVFDIPYQDYSPKPLDVLNCNDAASRDIYLALPMLNDAINEVAGQQGQAPGTLRYREHSDDVRDLHTE
GGDVSQLVLAQLAPRLMQGSEDLSAYSVLPLCRVKEKRPDGSLILDEEFIPTCTTLSVSTQLKGFMDEVE
GTLVERAQLLAKRIGSPGQQGIADVAEFMMLQVFNRTQPLFTHLAHQAILHPEAFYHQLVQTCGELRTFT
DESRLAGTFPVYNHDNLTDSFQPLFLAMRQALSTVLTPRAISIQLHMQAHGIRVATINDSDLLRSADFVL
AVRAQIPQEQLRRQFVQQTKITSLEKIRDLVSVQLPGVPLVALSAAPRQLPYHSGYTYFMLDLQSPVWKE
IQQSNAIAFHVSGDFPDLDMQFWAIRSS
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|384137007|ref|NC_017168.1|:1628928-1630274 Yersinia pestis A1122 chromosome, complete genome
ATGCCAACCAAAAATCGAGTGATTTGGCGCGAAGGGCTGTTCATCAAACCGCAACATTTTCAACAACAGC
AACGGCATAACGACTACCAGTTACAACGCCGGATTATCGCTCTGCAAGGGTATAGCTATGGTTTCAGTTC
ACTGATCCTGAATCAGGAGTTATTGAAATTAGGGCGTATTGGCTTGACGGTCGCCAGTGGCAATATGGCT
GATGGCACGGTGTTTGATATCCCTTATCAAGACTATTCACCAAAGCCATTGGATGTACTGAATTGTAATG
ATGCGGCCAGCCGTGACATTTATCTGGCATTACCGATGCTAAACGATGCCATTAATGAGGTGGCAGGCCA
GCAGGGGCAAGCGCCGGGAACCCTTCGCTATCGTGAACATAGCGATGATGTCCGCGATTTACATACCGAA
GGGGGCGATGTCAGCCAGTTGGTACTGGCACAACTGGCACCGCGTTTGATGCAAGGCTCGGAAGACCTCA
GTGCTTACTCGGTCCTGCCGCTGTGTCGGGTCAAAGAGAAACGGCCTGACGGTTCGCTGATCTTGGATGA
AGAGTTCATTCCCACCTGCACCACGCTCAGTGTCTCCACGCAGTTAAAAGGCTTTATGGATGAAGTCGAA
GGGACATTGGTTGAACGCGCCCAACTACTGGCGAAACGTATTGGTTCTCCCGGTCAGCAGGGGATCGCGG
ATGTGGCTGAATTTATGATGTTGCAGGTCTTTAACCGGACACAGCCGCTCTTTACCCATTTGGCACATCA
GGCGATTCTGCATCCAGAAGCGTTTTACCATCAGTTGGTACAAACCTGCGGTGAACTGCGCACGTTTACC
GATGAATCACGCTTAGCGGGCACCTTCCCGGTTTATAACCACGATAACTTGACCGACAGTTTTCAGCCGT
TGTTTTTGGCGATGCGTCAGGCATTAAGCACCGTGCTCACACCGCGTGCCATCTCTATCCAGTTGCATAT
GCAGGCACACGGTATTCGCGTTGCGACCATTAATGATAGTGATCTATTGCGCAGTGCTGATTTTGTGCTG
GCGGTTCGGGCGCAAATACCTCAAGAACAATTGCGTCGGCAGTTTGTTCAGCAAACCAAAATCACCTCAC
TTGAGAAAATACGCGATTTGGTCAGTGTCCAACTGCCCGGCGTCCCGTTGGTGGCACTGTCCGCCGCACC
GCGCCAGCTCCCTTACCACTCGGGATACACCTACTTCATGCTGGATCTGCAAAGCCCTGTATGGAAAGAA
ATCCAGCAAAGCAATGCGATTGCCTTCCACGTCTCGGGTGATTTCCCTGATCTGGACATGCAATTCTGGG
CAATCAGGAGCAGCTAA