SecReT6
Protein ID: 384138457
SecReT6 ID581
T6SS typei1
Gene symbol-
Locus tagA1122_07420
StrainYersinia pestis A1122
Repliconchromosome [GenBank: NC_017168] [Browse all T6SS(s) in this replicon]
Location [Strand]1640216..1640998 [+]
Producthypothetical protein
NoteTssA
UniProt IDG0JDZ3
KEGG IDypt:A1122_07420
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.20E-22, Aligned region: 41..101
Protein Sequence: 260 a.a.     [Download]
>gi|384138457|ref|YP_005521159.1| hypothetical protein A1122_07420 [Yersinia pestis A1122]
MSDTPQHIIIKTGTDPRNRPEFNAIREEINKINHPARPEVNWGLIESLALTLFRTHGVDLQTAVYYTLAR
TQKNGLAGFTEGCELLAGMVVGQWDHLWPEQPQARSEILEWFNTRVSNQLRQHDFTRDDLRLVYRAERAL
QLLYDKLQQVELKRVPRIENLLYLMQNTAKKLESASDAAKAQQTAAPLKMPPMVYLSVPEAEPVRTAAAA
PEPAANIEVRSPPRRLNGGRCCGALVPVSCVVYWWRLRFTLPSSNRCNSK
 
Nucleotide Sequence: 783 bp     [Download]
>gi|384137007|ref|NC_017168.1|:1640216-1640998 Yersinia pestis A1122 chromosome, complete genome
ATGAGTGACACCCCGCAACATATCATCATTAAAACCGGCACTGACCCACGGAACCGGCCGGAATTTAACG
CCATTCGTGAAGAGATCAACAAAATCAACCACCCGGCACGGCCAGAGGTCAACTGGGGTTTGATTGAATC
ACTGGCGCTGACCCTGTTCCGCACCCACGGCGTGGATTTGCAGACGGCGGTGTATTACACGCTGGCCCGC
ACCCAAAAAAATGGCCTGGCCGGTTTCACCGAGGGCTGCGAGTTGCTGGCCGGTATGGTAGTCGGCCAGT
GGGATCACCTGTGGCCGGAACAGCCGCAGGCACGCAGTGAAATACTGGAATGGTTCAATACCCGCGTCAG
CAATCAACTGCGTCAGCATGATTTTACCCGTGACGATCTGCGGCTGGTGTACCGCGCCGAGCGGGCCTTG
CAGTTGCTGTACGATAAATTGCAACAGGTTGAATTAAAACGGGTACCGCGCATTGAAAACTTGCTGTACC
TGATGCAGAACACCGCCAAAAAACTCGAATCGGCCAGTGATGCGGCGAAGGCTCAGCAAACCGCGGCCCC
GCTGAAAATGCCGCCTATGGTCTATCTCTCGGTACCCGAGGCCGAGCCTGTCCGGACGGCAGCGGCAGCC
CCTGAGCCTGCGGCCAATATTGAGGTGCGTTCGCCCCCCCGGCGACTAAACGGGGGGCGGTGCTGTGGGG
CTTTGGTGCCGGTGTCCTGTGTAGTTTACTGGTGGCGACTGCGGTTTACGTTACCCAGTTCAAACCGCTG
CAACAGCAAATGA