SecReT6
Protein ID: 384139200
SecReT6 ID582
T6SS typei3
Gene symbol-
Locus tagA1122_11210
StrainYersinia pestis A1122
Repliconchromosome [GenBank: NC_017168] [Browse all T6SS(s) in this replicon]
Location [Strand]2460376..2462058 [-]
Producthypothetical protein
NoteTagL
UniProt IDG0JA67, G0JA67
KEGG IDypt:A1122_11210
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 5.10E-18, Aligned region: 191..217
OmpA [PF00691], Evalue: 5.10E-18, Aligned region: 441..539
Protein Sequence: 560 a.a.     [Download]
>gi|384139200|ref|YP_005521902.1| hypothetical protein A1122_11210 [Yersinia pestis A1122]
MFKVKLNKTLSLLWLAAVGALLVSVNFKGNALWNNVIFITFLALMVLAIWKHYALKPKHPQVSTPIPQET
AEPVEQESTVILILGPYAEKWFSNPESPDSTRFSSHAVWILITNPAALQKRLTYIAEHHPSARVLTFFPF
LPDVYENAAVMMSKLTVWQNTFSTLSLRSPLPCVFAIYAQLSNERLSHNSDNAYWTGNINLANQQPIEIT
QALQSLSQRLELQDINHSRFATQRNVMAHNLFTWLNESGVTNLLQSIFSRTPLRLTDVILSDNGKGFIRH
GAWSAWLEKKFGIIPSLASTLSLPPFPAVINDQKPAMKPRVKTPVIKPTPASRGWLWSVCFAAVLLASHM
LNTLWQEKNRHEQFNQQMVPLDNISDFSAQYLARSITQLTDEGKILTTCVNTFDVTRWGLSQCKTLLSQI
NRRIESYENIPVFSFAQKLPLFDSNSTKLKLNSQTNEMMMELLSLVERNKEKKILIVGHSDNTGSSSMNM
ALSEQRALALRDWLIKRSDITVDNFITKGMGASEPVATNHTEAGREQNRRVEVLILPTQDRTRMTEPKPL
 
Nucleotide Sequence: 1683 bp     [Download]
>gi|384137007|ref|NC_017168.1|:c2462058-2460376 Yersinia pestis A1122 chromosome, complete genome
ATGTTTAAGGTTAAATTGAATAAAACGCTCTCTCTATTATGGCTGGCTGCGGTCGGCGCCCTATTGGTGA
GTGTGAATTTTAAGGGAAATGCGTTATGGAATAACGTTATTTTCATTACTTTCCTGGCGCTGATGGTTCT
TGCCATCTGGAAACATTACGCCCTCAAACCCAAACACCCCCAAGTGTCGACTCCCATTCCGCAGGAGACA
GCGGAACCTGTAGAACAGGAGAGTACGGTTATTTTAATTCTCGGTCCCTATGCTGAGAAATGGTTTAGTA
ACCCAGAATCGCCAGACAGTACACGTTTTTCCAGCCATGCGGTTTGGATATTAATCACGAATCCCGCCGC
GCTGCAAAAACGCCTCACATATATTGCTGAACATCATCCATCCGCTCGGGTATTGACCTTTTTCCCTTTC
TTGCCGGATGTCTATGAGAATGCAGCAGTGATGATGTCAAAACTCACTGTGTGGCAGAACACTTTTTCAA
CGTTATCACTGCGATCCCCCCTCCCCTGCGTATTTGCTATTTACGCGCAGTTGAGTAATGAACGCCTTAG
CCATAATTCTGATAACGCATATTGGACTGGAAATATTAATCTTGCGAACCAGCAGCCTATCGAGATTACG
CAAGCCCTACAGTCACTGAGCCAACGACTTGAGTTACAAGACATCAATCACTCAAGATTTGCAACTCAGC
GTAATGTTATGGCGCATAATTTATTTACTTGGTTGAATGAATCGGGGGTGACAAACCTTCTGCAATCTAT
TTTCTCTCGCACCCCCTTACGGCTAACAGATGTCATTTTGTCGGATAATGGCAAAGGGTTCATCAGGCAT
GGTGCCTGGTCAGCCTGGCTGGAAAAAAAGTTTGGCATCATACCAAGCTTAGCCTCAACCTTGTCACTGC
CACCTTTCCCAGCGGTGATCAATGACCAGAAGCCCGCAATGAAACCACGGGTGAAAACACCGGTGATAAA
ACCTACCCCCGCATCCCGCGGGTGGTTATGGAGTGTATGCTTCGCCGCGGTGCTATTAGCCTCACATATG
CTAAACACCCTGTGGCAAGAAAAAAACCGGCATGAGCAATTTAACCAACAGATGGTGCCGTTGGACAATA
TCAGCGATTTTTCTGCTCAGTACCTGGCACGCAGCATCACCCAGTTAACTGATGAAGGTAAAATATTAAC
CACATGCGTTAATACATTTGATGTCACACGTTGGGGGCTGTCTCAATGCAAGACGTTATTAAGCCAAATC
AACCGCCGGATTGAATCCTATGAAAATATTCCTGTTTTCAGTTTTGCCCAAAAGCTCCCTCTGTTTGACT
CAAACAGTACCAAGCTGAAACTGAACTCACAAACTAATGAAATGATGATGGAGTTGTTATCACTGGTCGA
ACGGAATAAAGAGAAAAAAATCTTAATTGTTGGCCATTCTGATAACACAGGCAGTTCCTCCATGAACATG
GCACTTTCCGAACAGCGTGCGCTGGCCCTTCGCGATTGGTTAATTAAACGCAGTGATATCACTGTCGATA
ATTTTATTACCAAGGGAATGGGGGCTTCAGAACCGGTTGCGACCAATCACACGGAAGCGGGTCGAGAACA
AAACAGACGCGTCGAAGTACTGATATTACCCACACAAGATAGAACAAGAATGACGGAGCCTAAACCTTTA
TGA