SecReT6
Protein ID: 384139204
SecReT6 ID582
T6SS typei3
Gene symbol-
Locus tagA1122_11230
StrainYersinia pestis A1122
Repliconchromosome [GenBank: NC_017168] [Browse all T6SS(s) in this replicon]
Location [Strand]2465154..2466335 [-]
Producthypothetical protein
NoteTssA
UniProt IDG0JA71
KEGG IDypt:A1122_11230
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.60E-18, Aligned region: 62..121
ImpA-rel_N [PF06812], Evalue: 3.60E-18, Aligned region: 203..215
Protein Sequence: 393 a.a.     [Download]
>gi|384139204|ref|YP_005521906.1| hypothetical protein A1122_11230 [Yersinia pestis A1122]
MSEQSIAERAGYYQSMMQPIPGDFPCGKNLEYDPAFIMLQTKLQPKQAAEYGNFVEVAEPNNWTDIERKC
LELLNNSRDIRLFIILMRCRMRQVGVGALQEGLEAILWCLDTWPDQLHPQLFDEGEFEPLMRGNAFAELE
DIDGFIADFRNQQLPKAAGVQLSIKEFEKAHSVPREEGALDEGTLEAVKQEWQNRSDHTILSLQHAYALL
QGLATRLNNSLGEDTPDFVRMTSVLRHFDAAITPIAPIVVPIPEVVELYPVATAMLASTEMPVTAEVQTV
AETQMAIPIEAPQQRQAVVTPSPQLQPLQLQSAQLQPVPIQSQPVPVQQQGIQNRADALARLIEVREWFT
AMEPSSPVIALLAFSEKTIGKSFGELLQFIPQELISKLNEGQE
 
Nucleotide Sequence: 1182 bp     [Download]
>gi|384137007|ref|NC_017168.1|:c2466335-2465154 Yersinia pestis A1122 chromosome, complete genome
ATGAGTGAACAGAGTATCGCTGAACGTGCCGGTTATTATCAAAGCATGATGCAGCCCATTCCAGGTGACT
TTCCTTGTGGCAAAAATCTGGAATATGACCCGGCATTTATTATGCTACAGACAAAATTGCAACCTAAGCA
GGCCGCTGAATACGGCAATTTTGTTGAGGTCGCTGAACCCAATAACTGGACAGATATCGAGCGTAAATGC
CTTGAACTCCTGAATAATTCTCGGGATATTCGGCTGTTTATTATTCTGATGCGCTGCCGGATGCGTCAGG
TCGGTGTGGGCGCGTTGCAAGAAGGGCTGGAAGCCATACTTTGGTGCCTCGACACTTGGCCTGATCAGCT
ACATCCTCAGTTGTTTGATGAAGGGGAATTTGAACCTTTAATGCGCGGTAATGCTTTTGCTGAACTGGAA
GATATTGATGGTTTTATCGCCGACTTCCGTAATCAGCAGTTACCCAAAGCCGCTGGCGTGCAACTTTCCA
TCAAAGAGTTTGAAAAAGCACACTCCGTTCCTCGAGAAGAAGGGGCATTGGACGAAGGGACTCTGGAAGC
CGTTAAGCAAGAGTGGCAGAACCGATCAGATCACACCATTCTCTCACTCCAGCACGCTTATGCCTTGTTG
CAAGGATTAGCCACGCGCCTCAACAACTCCCTCGGTGAAGACACACCTGATTTTGTCAGAATGACCTCAG
TGTTACGCCACTTTGATGCCGCGATAACCCCGATAGCGCCTATCGTGGTGCCGATCCCAGAAGTTGTCGA
GCTCTATCCAGTCGCCACAGCGATGCTAGCAAGCACAGAAATGCCAGTGACCGCCGAGGTACAGACGGTT
GCAGAGACACAAATGGCCATACCCATTGAAGCTCCCCAACAGCGTCAAGCGGTGGTAACCCCATCCCCAC
AGTTGCAGCCGTTACAGTTGCAATCGGCACAGTTGCAACCTGTACCGATACAGTCACAGCCGGTGCCTGT
CCAGCAGCAAGGGATCCAAAACAGGGCTGATGCATTAGCCCGGCTTATAGAGGTGCGAGAGTGGTTTACC
GCCATGGAACCGAGTAGCCCGGTCATTGCCTTACTGGCTTTTTCAGAAAAAACTATCGGCAAAAGCTTCG
GCGAATTGCTGCAGTTCATTCCTCAGGAACTGATTTCGAAACTCAATGAAGGACAGGAGTAA