SecReT6
Protein ID: 384139215
SecReT6 ID582
T6SS typei3
Gene symbol-
Locus tagA1122_11285
StrainYersinia pestis A1122
Repliconchromosome [GenBank: NC_017168] [Browse all T6SS(s) in this replicon]
Location [Strand]2479830..2481332 [+]
Producthypothetical protein
NoteTssC
UniProt IDG0JA82
KEGG IDypt:A1122_11285
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.90E-194, Aligned region: 68..494
Protein Sequence: 500 a.a.     [Download]
>gi|384139215|ref|YP_005521917.1| hypothetical protein A1122_11285 [Yersinia pestis A1122]
MSTQDAKTKQATVASATEYSDFNTLLTKEFKAKSEQTIAAVEGAVKTLAEQALANSVTVSDDAYKSIASI
IAEIDRKLSDQINLILHHQEFQSLESAWRGLHYLVNNTETDEKLRLRFLDISKDELRRNMKRYKGVAWDQ
SPLFKKIYEEEYGQLGGEPYGCLVADYYFDHTAPDVDLLASIGKVAASAHVPFITGAAPSVLQMESWQEL
SNPRDLTKIFTQNLEYAAWNSLRQSEDSRYIGLAMPRFLSRLPYGINTNPVDAFHFEETTDGADHSKYVW
SNAAYAMAVNINRSFKEYGWCTLIRGVESGGVVEGLPCHTFPTDDGGIDMKCPTEIAISDRREAELAKNG
FIPLVHRKNTDYAAFIGAQSLQKPAEYYDSDATANANLSARLPYLFACSRFAHYLKCIVRDKIGSFKERD
EMQRWLNDWVMNYVDGDPANSSLETKARRPLAAAEVIVEEVEGNPGYYQAKFFLRPHFQLEGLTVSLRMV
AKLPSLKDVA
 
Nucleotide Sequence: 1503 bp     [Download]
>gi|384137007|ref|NC_017168.1|:2479830-2481332 Yersinia pestis A1122 chromosome, complete genome
ATGTCCACTCAAGACGCAAAAACTAAACAAGCTACAGTCGCCAGTGCGACGGAATATAGCGATTTTAATA
CATTACTGACTAAAGAATTTAAAGCGAAGTCTGAGCAAACGATAGCCGCAGTAGAAGGTGCCGTTAAAAC
GTTGGCTGAGCAAGCGCTGGCTAATTCGGTCACGGTGTCAGACGATGCTTATAAAAGTATTGCTTCCATT
ATTGCAGAGATTGATCGCAAGCTATCAGATCAGATTAACTTAATTTTGCACCACCAAGAATTCCAGTCTC
TGGAAAGCGCATGGCGTGGGCTGCACTATTTAGTCAATAACACCGAGACTGATGAGAAGTTGAGATTACG
TTTCCTCGACATTTCTAAAGATGAATTACGCCGTAACATGAAGCGTTATAAAGGTGTTGCTTGGGATCAA
AGCCCATTATTCAAAAAAATCTATGAAGAAGAATATGGCCAATTGGGTGGCGAACCATACGGTTGCCTGG
TAGCAGACTATTACTTTGACCATACTGCACCTGACGTTGACTTGTTGGCTTCAATTGGCAAAGTTGCCGC
TTCTGCCCACGTGCCATTTATTACAGGTGCTGCACCGTCTGTGTTGCAAATGGAATCTTGGCAAGAACTG
TCAAACCCACGTGATTTGACGAAGATCTTCACTCAGAATCTTGAGTATGCCGCATGGAACTCACTGCGTC
AGTCTGAAGACTCTCGCTATATCGGCCTGGCGATGCCACGTTTCTTGTCGCGTCTGCCTTATGGGATTAA
CACCAATCCGGTAGATGCCTTCCACTTTGAAGAGACGACTGATGGCGCGGATCACAGCAAATATGTGTGG
TCAAATGCGGCTTATGCGATGGCTGTTAACATCAACCGATCTTTCAAAGAGTATGGCTGGTGTACGCTGA
TTCGTGGTGTGGAAAGTGGTGGTGTTGTTGAAGGCCTGCCATGCCATACCTTCCCGACGGATGACGGCGG
TATTGATATGAAATGCCCAACAGAAATCGCTATTTCTGACCGTCGTGAAGCGGAACTGGCCAAGAATGGC
TTTATTCCACTGGTTCACAGAAAGAATACGGATTACGCGGCATTCATTGGCGCGCAGTCCCTGCAAAAAC
CTGCAGAATATTACGATTCGGATGCAACGGCGAACGCCAACCTTTCCGCTCGTCTGCCATACCTGTTTGC
TTGTTCACGTTTTGCACATTATCTGAAGTGCATCGTGCGTGACAAAATCGGCTCTTTTAAAGAGCGTGAT
GAGATGCAACGTTGGTTGAATGATTGGGTGATGAACTATGTTGATGGTGACCCAGCTAACTCTTCCCTGG
AAACTAAAGCGCGCCGTCCTTTAGCCGCCGCTGAAGTGATTGTTGAAGAAGTTGAAGGTAACCCTGGTTA
CTATCAGGCTAAATTCTTCTTACGCCCTCATTTCCAGTTAGAAGGTTTGACAGTATCCCTGCGTATGGTT
GCTAAACTGCCTTCGCTGAAAGACGTAGCATAA