SecReT6
Protein ID: 384139217
SecReT6 ID582
T6SS typei3
Gene symbol-
Locus tagA1122_11295
StrainYersinia pestis A1122
Repliconchromosome [GenBank: NC_017168] [Browse all T6SS(s) in this replicon]
Location [Strand]2482396..2482956 [+]
Producthypothetical protein
NoteTssJ
UniProt IDG0JA84
KEGG IDypt:A1122_11295
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.00E-36, Aligned region: 29..179
Protein Sequence: 186 a.a.     [Download]
>gi|384139217|ref|YP_005521919.1| hypothetical protein A1122_11295 [Yersinia pestis A1122]
MILIRLSMNKSIRGVYRATQYLFLVLVTLLTIACSSKVQPEKAEKLTVEIATAADINPNDKGVANPLRIA
LYTLKSTDEFQSSDFFTITEENTPSLKEQMDNVFDRIMLPSETKKIELTLDAGVTAIGIVAAYREIEQAE
WKAVIYPLPKKRVDPWYKKMWPGQDQQDPIMKVRVERLSISIKEMD
 
Nucleotide Sequence: 561 bp     [Download]
>gi|384137007|ref|NC_017168.1|:2482396-2482956 Yersinia pestis A1122 chromosome, complete genome
ATGATTTTAATTAGGCTAAGTATGAATAAAAGTATCCGAGGGGTTTACCGGGCGACACAGTACTTATTTT
TGGTACTGGTAACGTTATTGACGATAGCCTGTAGTTCAAAAGTGCAACCTGAAAAGGCTGAAAAGCTTAC
CGTCGAAATCGCGACAGCAGCGGATATTAATCCGAATGATAAAGGGGTGGCGAACCCGCTAAGGATTGCA
CTTTATACACTCAAGAGCACCGATGAATTTCAGTCGAGTGATTTCTTCACTATCACTGAAGAAAATACGC
CATCGCTAAAAGAACAAATGGATAACGTGTTTGACCGGATTATGTTGCCAAGCGAGACCAAAAAAATAGA
GCTGACACTTGATGCTGGCGTTACTGCTATCGGCATCGTGGCTGCTTATCGTGAAATTGAACAGGCGGAG
TGGAAAGCGGTTATTTATCCGTTGCCCAAAAAACGCGTGGATCCTTGGTATAAAAAAATGTGGCCAGGGC
AAGACCAACAAGATCCGATCATGAAGGTACGCGTTGAGCGTCTGTCAATATCAATTAAAGAAATGGATTA
A