SecReT6
Protein ID: 384139218
SecReT6 ID582
T6SS typei3
Gene symbol-
Locus tagA1122_11300
StrainYersinia pestis A1122
Repliconchromosome [GenBank: NC_017168] [Browse all T6SS(s) in this replicon]
Location [Strand]2482960..2484309 [+]
Producthypothetical protein
NoteTssK
UniProt IDG0JA85
KEGG IDypt:A1122_11300
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.50E-144, Aligned region: 19..447
Protein Sequence: 449 a.a.     [Download]
>gi|384139218|ref|YP_005521920.1| hypothetical protein A1122_11300 [Yersinia pestis A1122]
MRTNKVVWSEGLFLRPQLFQQQERYLEYYAHKRAATITPFFWGFAQYEIDREALSYGKLVLRSGKGVLPD
GTPFDIPGHAELPEPLTITPEHLGKLIYLAVPLRLDNSDETIFDEHDMSSLARFYAYEAALNDTNAIRQG
PKPVQLSRLRLRLVSEGEMTESWIGLPLTKVRAIQPDGSVLLHTEDYIPPVTGYAASSLLSEWLTHLNGL
VKMRAEMLANRLSNSDGKASASAEIVDYLLLQIFNKYEPILDHLRHIPELPPITLYQELAKFSGELSTFI
RTKTRRPRPAPGYDHAKLYASIRPLVDEVHELLNQILVRAGQMIPLETKGNGVWSASVLPNELRSFSNLV
LAVHAQLPMDVLQHQFSVQTKISAPQQLHELVRSHLPGLELQRLPVPPRQIPYSAGYVYFELIKNGPFWD
KVSNAGAIALHVAGDFPALKMELWGIRDS
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|384137007|ref|NC_017168.1|:2482960-2484309 Yersinia pestis A1122 chromosome, complete genome
GTGAGAACTAACAAAGTCGTTTGGAGTGAGGGGCTTTTTCTTCGCCCACAACTTTTTCAACAGCAAGAGC
GCTATCTTGAATATTACGCCCATAAGCGAGCTGCAACGATAACCCCATTCTTTTGGGGATTTGCGCAATA
TGAAATTGATAGAGAAGCACTCTCGTATGGCAAATTAGTATTGCGATCTGGGAAGGGCGTGTTACCCGAC
GGTACACCATTTGATATTCCCGGCCATGCTGAATTGCCTGAACCGCTCACTATCACCCCAGAACATCTGG
GTAAGTTGATCTATCTGGCGGTACCACTGCGCCTGGATAACAGTGATGAAACCATTTTTGATGAGCACGA
TATGAGCTCATTGGCACGTTTTTACGCCTATGAAGCTGCGCTCAACGATACCAATGCCATTCGGCAAGGG
CCGAAGCCGGTACAACTGTCAAGATTACGTCTCAGATTAGTCTCAGAAGGTGAGATGACAGAATCATGGA
TTGGGCTGCCATTAACCAAAGTCAGAGCGATTCAGCCTGATGGGAGTGTCTTGCTACACACCGAAGACTA
TATTCCTCCGGTGACGGGTTATGCCGCAAGTTCATTGCTGTCTGAATGGCTAACCCATCTTAATGGTTTG
GTTAAAATGCGCGCAGAGATGTTGGCCAATCGCTTGTCAAACAGTGATGGGAAAGCGAGCGCCAGCGCAG
AAATTGTCGATTATTTGTTACTGCAAATTTTTAATAAATATGAGCCGATTCTCGATCATTTAAGGCATAT
TCCTGAATTACCGCCTATTACGCTTTATCAGGAATTGGCTAAGTTCTCGGGGGAATTATCTACCTTTATC
CGGACCAAAACCCGCCGACCCCGCCCGGCACCTGGCTATGATCATGCGAAGCTCTATGCGTCTATTCGTC
CGTTGGTTGACGAAGTTCATGAACTACTGAACCAGATCTTGGTGCGTGCTGGGCAGATGATACCGCTGGA
GACGAAAGGCAATGGCGTTTGGTCTGCCTCCGTACTGCCTAATGAATTACGCTCGTTTTCAAATCTGGTC
CTTGCCGTTCATGCGCAATTACCGATGGATGTGCTACAGCATCAATTTTCAGTACAAACAAAAATCAGCG
CACCTCAGCAATTGCATGAACTGGTGCGATCGCATTTGCCAGGGTTGGAACTACAGCGTTTGCCGGTACC
GCCCAGACAAATTCCGTATAGCGCAGGGTACGTTTATTTTGAATTGATAAAAAATGGCCCCTTCTGGGAC
AAAGTTTCCAATGCTGGTGCCATTGCCCTGCATGTGGCGGGTGATTTCCCTGCCTTGAAAATGGAGCTCT
GGGGGATTAGAGATTCATGA