SecReT6
Protein ID: 384139219
SecReT6 ID582
T6SS typei3
Gene symbol-
Locus tagA1122_11305
StrainYersinia pestis A1122
Repliconchromosome [GenBank: NC_017168] [Browse all T6SS(s) in this replicon]
Location [Strand]2484306..2484974 [+]
Producthypothetical protein
NoteTssL
UniProt IDG0JA86
KEGG IDypt:A1122_11305
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.60E-29, Aligned region: 86..198
Protein Sequence: 222 a.a.     [Download]
>gi|384139219|ref|YP_005521921.1| hypothetical protein A1122_11305 [Yersinia pestis A1122]
MSDSSDLNLGGSMPPFDRSRNVDESPQALGRFLLDEPMTSPDSTQDNTAFTREAPHSGAAQQYDTTLLRG
ESVQQRVAKVLASSTPLLEAAQPLLRALSEMPAHIGDVSQVHILKQSLKNEITLFSVVCDEADISWKKMA
IVRYCLCTALDEAAHTMSWGMMAGWSQSNLLNHFEGDNDGGNKFFLLVGRLSMSPHEYAVTNGAIVIHTQ
RLKSDPGGNLLS
 
Nucleotide Sequence: 669 bp     [Download]
>gi|384137007|ref|NC_017168.1|:2484306-2484974 Yersinia pestis A1122 chromosome, complete genome
ATGAGTGACAGCAGTGATTTGAACCTTGGAGGCTCAATGCCTCCTTTTGATAGAAGCAGAAATGTGGATG
AGAGTCCGCAGGCATTAGGCCGGTTCTTGCTTGATGAGCCAATGACATCCCCAGATAGCACTCAGGATAA
TACGGCCTTCACTAGAGAGGCCCCTCATTCTGGTGCGGCACAGCAATATGACACGACCCTCTTACGGGGT
GAAAGTGTGCAACAGCGTGTCGCTAAAGTACTCGCATCTTCAACGCCATTATTGGAAGCGGCACAGCCAC
TATTACGTGCCTTGAGCGAGATGCCCGCGCATATTGGGGATGTTTCACAGGTTCATATATTAAAACAAAG
CCTTAAAAATGAGATCACCCTCTTTAGTGTGGTGTGTGATGAAGCGGATATCTCATGGAAAAAAATGGCT
ATCGTCCGCTATTGCCTGTGTACTGCGTTGGATGAAGCCGCTCACACGATGTCGTGGGGAATGATGGCAG
GTTGGTCACAAAGCAACCTGTTGAACCATTTTGAAGGCGATAATGACGGCGGGAATAAGTTTTTCTTATT
GGTCGGCCGTCTCTCTATGAGCCCGCATGAATATGCTGTAACGAACGGTGCAATAGTGATCCACACCCAA
CGCCTGAAATCAGATCCAGGGGGTAATCTGCTCTCCTGA