SecReT6
Protein ID: 384139431
SecReT6 ID583
T6SS typeN/A
Gene symbol-
Locus tagA1122_12405
StrainYersinia pestis A1122
Repliconchromosome [GenBank: NC_017168] [Browse all T6SS(s) in this replicon]
Location [Strand]2701212..2701691 [-]
Producthypothetical protein
NoteTssE
UniProt IDG0JI49
KEGG IDypt:A1122_12405
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.20E-16, Aligned region: 35..138
Protein Sequence: 159 a.a.     [Download]
>gi|384139431|ref|YP_005522133.1| hypothetical protein A1122_12405 [Yersinia pestis A1122]
MEKKKQFLPALLERLLDDEPKKHIEPHDKFFYDSRTMRKLVQRNISEILNNANIEDRLDPQRHKWVATSV
LNYGISPLVGLYAVPHNWATIERIIREAIIRFEPRIMAESLVVSQQLQARNGIIQFEIRGLIKWNPHPID
LCIEGAYDVETDNAELRAR
 
Nucleotide Sequence: 480 bp     [Download]
>gi|384137007|ref|NC_017168.1|:c2701691-2701212 Yersinia pestis A1122 chromosome, complete genome
ATGGAAAAGAAAAAACAGTTTTTACCGGCGTTGTTAGAGCGTTTACTCGATGATGAGCCTAAAAAGCATA
TTGAGCCTCACGATAAATTCTTTTATGACTCACGGACGATGCGGAAATTGGTACAACGTAATATTTCAGA
GATATTAAATAATGCCAATATTGAAGACCGGTTGGATCCGCAGCGTCATAAATGGGTAGCGACGTCGGTC
TTAAACTATGGTATTTCACCCCTGGTCGGGCTTTATGCCGTGCCGCATAATTGGGCGACTATTGAACGAA
TTATCAGAGAGGCCATTATCCGTTTTGAACCACGGATAATGGCGGAATCTCTCGTTGTCAGCCAGCAACT
CCAGGCCAGGAATGGCATTATACAGTTTGAGATTAGGGGGTTAATCAAATGGAACCCGCACCCTATCGAT
CTTTGTATTGAAGGTGCCTATGACGTTGAGACGGATAACGCAGAGCTACGCGCCCGTTGA