SecReT6
Protein ID: 384139432
SecReT6 ID583
T6SS typeN/A
Gene symbol-
Locus tagA1122_12410
StrainYersinia pestis A1122
Repliconchromosome [GenBank: NC_017168] [Browse all T6SS(s) in this replicon]
Location [Strand]2701788..2702594 [-]
Producthypothetical protein
NoteTagJ
UniProt IDG0JI50
KEGG IDypt:A1122_12410
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 6.00E-45, Aligned region: 145..263
TPR_11 [PF13414], Evalue: 0.0041, Aligned region: 47..76
TPR_11 [PF13414], Evalue: 0.0041, Aligned region: 105..136
Protein Sequence: 268 a.a.     [Download]
>gi|384139432|ref|YP_005522134.1| hypothetical protein A1122_12410 [Yersinia pestis A1122]
MNTTNLTELLKSASLTEMLADVIATIKAKPTDTDTRELLFKLYCIDGSWQKALLQLETLTQLLPEFTKQA
ELYKNLILSEKMRDEVLAGKRSPGTLGNDLPEWVALLQQANQLHHDGDHQQSEALREQALQQAPESIGES
AATGCFAWIADSDGRMGPVCEFISAGGYRWIPFAEIQSLTVSKPKNITDLIWAPAQVKVKDKVWYGYIPA
RYPLTPETDNETKLGLKTEWHQPTDSLYIGAGRKMFITDQGEHALFDIEEIVFEIDCI
 
Nucleotide Sequence: 807 bp     [Download]
>gi|384137007|ref|NC_017168.1|:c2702594-2701788 Yersinia pestis A1122 chromosome, complete genome
ATGAATACCACGAATTTAACTGAGTTATTAAAAAGCGCGTCTTTAACCGAAATGCTGGCCGATGTCATTG
CTACGATAAAAGCTAAACCAACGGACACCGATACGCGAGAACTGTTATTCAAACTCTATTGTATTGATGG
TTCATGGCAAAAAGCCCTATTGCAGCTTGAAACATTGACACAGCTTTTACCTGAGTTCACCAAACAGGCT
GAACTCTATAAAAATCTGATATTGAGTGAGAAAATGCGTGATGAAGTGCTGGCAGGCAAACGCAGCCCTG
GTACATTGGGTAACGACCTGCCTGAATGGGTAGCCTTGTTGCAACAAGCTAATCAACTCCACCATGATGG
CGATCATCAGCAAAGTGAGGCCCTCCGTGAACAGGCTCTGCAACAGGCACCGGAAAGTATCGGAGAGAGT
GCTGCGACAGGCTGCTTCGCTTGGATTGCTGACAGTGATGGGCGCATGGGGCCTGTTTGTGAGTTTATTA
GCGCCGGCGGTTACCGTTGGATCCCGTTTGCAGAGATACAATCACTCACTGTTTCCAAACCTAAAAATAT
TACAGACCTGATATGGGCGCCGGCACAGGTTAAAGTAAAGGATAAAGTTTGGTACGGTTATATACCTGCC
CGCTATCCACTGACACCTGAAACAGACAATGAAACTAAACTGGGTCTTAAAACAGAATGGCATCAACCGA
CTGACTCACTTTATATTGGGGCAGGGCGGAAAATGTTTATCACCGACCAAGGTGAGCATGCGCTGTTTGA
TATTGAAGAGATTGTATTTGAGATAGATTGTATTTGA