SecReT6
Protein ID: 384139437
SecReT6 ID583
T6SS typeN/A
Gene symbol-
Locus tagA1122_12435
StrainYersinia pestis A1122
Repliconchromosome [GenBank: NC_017168] [Browse all T6SS(s) in this replicon]
Location [Strand]2710734..2711525 [-]
ProductSciP protein
NoteTssL
UniProt IDG0JI55
KEGG IDypt:A1122_12435
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.00E-18, Aligned region: 3..96
OmpA [PF00691], Evalue: 1.50E-16, Aligned region: 157..255
Protein Sequence: 263 a.a.     [Download]
>gi|384139437|ref|YP_005522139.1| SciP protein [Yersinia pestis A1122]
MTYADGLEVLLRILGLGFEGRYSIIEDGDRQLTKIRQGLLTLLQSTRDTIPPALSPHGLIAHQNRRRRGI
FVPVRVSMLLCGFLIVATFIGCKYFLSVPESDLLKRMGALQRVVVTPPVAAPKLRLSILLKDEIAKQLVS
VDETSNNSKVIFKGDSMFMVGSDNVRPEMIDVIKRVAQEVHRVKGAILIVGHTDSMPINKPGFPNNQVLS
EKRAANVARYMEQAGIPTDKIRFEGKGETQPVSSNDDATGRSQNRRVEIFVNY
 
Nucleotide Sequence: 792 bp     [Download]
>gi|384137007|ref|NC_017168.1|:c2711525-2710734 Yersinia pestis A1122 chromosome, complete genome
TTGACATATGCGGATGGTTTAGAGGTTTTGCTGCGCATTTTAGGGCTCGGTTTTGAGGGGCGCTACAGCA
TTATCGAAGATGGTGATCGGCAATTAACTAAAATACGCCAAGGGTTGCTGACGCTGCTCCAAAGTACCCG
AGACACGATCCCACCGGCACTTTCTCCGCATGGGTTGATCGCACATCAAAACAGAAGACGGCGGGGCATT
TTTGTTCCGGTGCGCGTATCCATGCTGTTGTGTGGTTTCCTCATTGTCGCGACCTTTATTGGATGTAAAT
ACTTTCTCTCGGTACCGGAAAGTGACTTGCTAAAAAGAATGGGAGCATTGCAACGTGTGGTTGTGACGCC
ACCCGTTGCCGCACCAAAACTTCGACTGTCTATTTTATTAAAAGATGAGATAGCGAAGCAGTTAGTCAGT
GTTGATGAAACGAGCAACAACAGCAAAGTCATCTTTAAAGGCGACTCTATGTTTATGGTCGGCTCGGATA
ACGTCAGACCTGAAATGATTGACGTAATTAAACGCGTCGCGCAGGAAGTGCATCGCGTTAAAGGGGCAAT
CCTCATCGTCGGGCATACAGACTCTATGCCGATTAATAAACCCGGCTTCCCTAATAACCAGGTACTTTCC
GAAAAACGCGCGGCCAATGTTGCACGCTATATGGAGCAGGCCGGTATTCCAACCGACAAAATTCGGTTTG
AGGGCAAGGGGGAAACGCAACCGGTTAGCAGCAATGACGATGCGACAGGACGTTCGCAAAACCGCCGCGT
AGAAATTTTTGTTAATTATTGA