SecReT6
Protein ID: 384140630
SecReT6 ID584
T6SS typei2
Gene symbol-
Locus tagA1122_18475
StrainYersinia pestis A1122
Repliconchromosome [GenBank: NC_017168] [Browse all T6SS(s) in this replicon]
Location [Strand]3970535..3970987 [-]
Producthypothetical protein
NoteTssE
UniProt IDG0JCN5
KEGG IDypt:A1122_18475
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.00E-14, Aligned region: 31..116
Protein Sequence: 150 a.a.     [Download]
>gi|384140630|ref|YP_005523332.1| hypothetical protein A1122_18475 [Yersinia pestis A1122]
MPDTSSPSLYEQLLGNFTGGLDLHQVSDENQVILSVLDNMQRILNCRAGTLSHLPDYGLPDMSKILQGLP
GSAHSLLTTLSATLLKYEPRLKSLQVILLPQTTPGHLEYAIDAELKGLGLVRYGTAFMPEGRVLMRHLKQ
QHYLNQRESF
 
Nucleotide Sequence: 453 bp     [Download]
>gi|384137007|ref|NC_017168.1|:c3970987-3970535 Yersinia pestis A1122 chromosome, complete genome
ATGCCGGATACCTCCTCGCCGTCACTGTATGAGCAATTGCTGGGCAATTTCACCGGCGGGCTTGACCTGC
ATCAGGTCAGTGACGAAAACCAGGTCATTCTCTCGGTGCTGGACAATATGCAGCGCATTCTTAATTGTCG
GGCCGGAACACTCAGTCATCTGCCCGATTATGGCCTGCCGGACATGAGTAAAATTCTGCAGGGGTTGCCG
GGCAGCGCGCATTCGCTGCTGACCACGCTGTCCGCCACCTTGCTGAAGTACGAGCCGCGTCTGAAAAGTT
TGCAGGTGATTCTGTTGCCACAGACCACACCCGGTCATCTGGAATACGCCATTGATGCGGAGCTGAAAGG
GCTGGGACTGGTGCGCTATGGCACGGCGTTTATGCCGGAGGGCCGGGTGCTGATGCGCCACCTTAAACAA
CAACACTACCTCAATCAGCGGGAGTCATTTTGA