SecReT6
Protein ID: 384140650
SecReT6 ID584
T6SS typei2
Gene symbol-
Locus tagA1122_18575
StrainYersinia pestis A1122
Repliconchromosome [GenBank: NC_017168] [Browse all T6SS(s) in this replicon]
Location [Strand]3996306..3996797 [-]
Producthypothetical protein
NoteTssD
UniProt IDG0JCQ5
KEGG IDypt:A1122_00115, ypt:A1122_18575
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.00E-36, Aligned region: 6..146
Protein Sequence: 163 a.a.     [Download]
>gi|384140650|ref|YP_005523352.1| hypothetical protein A1122_18575 [Yersinia pestis A1122]
MAIPVYLWLKDDGGADIKGSVDVQSREGSIEIVAQDHNLYIPTDNNTGKLTGTRIHTPFVFTKEIDASTP
YLYKAVTTGQTLKTAEFKWYRIDDAGQEVEYFNTKLENVKVVKVAPKMHDVKDPAKEKHNHLELVELRYE
KITWTFKDGNIIHSDSWNERATA
 
Nucleotide Sequence: 492 bp     [Download]
>gi|384137007|ref|NC_017168.1|:c3996797-3996306 Yersinia pestis A1122 chromosome, complete genome
ATGGCAATTCCAGTTTATCTGTGGCTGAAAGACGACGGCGGTGCGGACATCAAGGGTTCTGTTGATGTGC
AAAGCCGTGAAGGCAGCATTGAGATCGTGGCACAGGACCATAACCTGTACATCCCAACCGATAACAATAC
CGGCAAACTGACCGGTACCCGTATCCACACCCCGTTCGTATTCACCAAAGAAATCGATGCGTCGACCCCG
TACCTGTACAAAGCGGTGACCACCGGTCAGACACTGAAAACCGCCGAGTTCAAATGGTACCGCATTGATG
ACGCTGGCCAGGAAGTTGAATATTTCAACACCAAACTGGAAAACGTCAAAGTGGTTAAAGTTGCGCCGAA
AATGCACGACGTGAAAGATCCGGCGAAAGAGAAGCACAACCACCTGGAACTGGTGGAACTGCGCTACGAA
AAAATCACCTGGACCTTTAAAGACGGCAACATCATTCATTCCGATTCGTGGAACGAGCGCGCCACCGCAT
AG