SecReT6
Protein ID: 384140655
SecReT6 ID584
T6SS typei2
Gene symbol-
Locus tagA1122_18600
StrainYersinia pestis A1122
Repliconchromosome [GenBank: NC_017168] [Browse all T6SS(s) in this replicon]
Location [Strand]4002177..4002677 [-]
Producthypothetical protein
NoteTssB
UniProt IDG0JCR0
KEGG IDypt:A1122_18600
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.90E-56, Aligned region: 7..159
Protein Sequence: 166 a.a.     [Download]
>gi|384140655|ref|YP_005523357.1| hypothetical protein A1122_18600 [Yersinia pestis A1122]
MSSSSFQNEIPKARINIKLDLHTGGAQKKVELPLKLLVMGDYSNGQEQRPLSEREKLNINKNNFNSVLAE
FQPSLKLAVPDTLAGDNTDTAVALTFREMKDFEPESVARQIPQLRALLAMRNLLRDLKSNLLDNATFRRE
LENILKDDALSDELRAELAALAPKEG
 
Nucleotide Sequence: 501 bp     [Download]
>gi|384137007|ref|NC_017168.1|:c4002677-4002177 Yersinia pestis A1122 chromosome, complete genome
ATGTCCTCTTCAAGCTTCCAAAATGAGATACCTAAAGCACGCATTAACATCAAATTAGACCTGCATACTG
GCGGGGCGCAAAAGAAAGTCGAACTGCCTTTGAAGTTGTTGGTGATGGGCGATTACAGCAACGGTCAGGA
GCAGCGCCCGCTGTCTGAACGTGAAAAACTCAATATCAATAAAAATAATTTTAACAGTGTGCTGGCTGAA
TTCCAACCGAGCCTGAAACTCGCTGTACCGGACACGCTGGCCGGGGATAACACCGATACAGCCGTCGCTT
TGACCTTCCGCGAGATGAAAGATTTCGAACCGGAAAGCGTCGCCCGTCAAATCCCGCAACTGCGTGCCTT
GCTGGCCATGCGCAACCTGCTGCGAGACCTCAAATCCAATCTGCTGGACAACGCCACCTTCCGCCGTGAG
CTGGAAAATATCCTCAAAGACGATGCCTTGAGCGATGAACTGCGCGCTGAACTGGCGGCCCTGGCACCAA
AAGAGGGTTAA