SecReT6
Protein ID: 384142700
SecReT6 ID585
T6SS typei4b
Gene symbol-
Locus tagABZJ_01454
StrainAcinetobacter baumannii MDR-ZJ06
Repliconchromosome [GenBank: NC_017171] [Browse all T6SS(s) in this replicon]
Location [Strand]1508063..1508566 [+]
Producthypothetical protein
NoteTssB
UniProt IDG2JH64
KEGG IDabz:ABZJ_01454
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.80E-58, Aligned region: 11..166
Protein Sequence: 167 a.a.     [Download]
>gi|384142700|ref|YP_005525410.1| hypothetical protein [Acinetobacter baumannii MDR-ZJ06]
MAKRESVQKKLQRIRPPRVQLTYDVEIGDAKEAKELPFVVGVMGDFSAASELERTKLKDKKFINVDLDNI
DEVMESLSPRAAFQVDNTLTEEGGKMAVDLTFKSMEDFRPENVVQQVDPLKKLVEARERLTDLRNKISNS
ERLEDLLDEVLKNTDQIRKLSAEADHE
 
Nucleotide Sequence: 504 bp     [Download]
>gi|384141246|ref|NC_017171.1|:1508063-1508566 Acinetobacter baumannii MDR-ZJ06 chromosome, complete genome
ATGGCTAAGAGAGAAAGCGTACAAAAGAAGCTTCAGCGAATTCGACCTCCTCGTGTTCAGCTTACATATG
ATGTCGAAATTGGTGATGCGAAAGAAGCGAAAGAACTACCATTCGTTGTAGGTGTAATGGGTGATTTTTC
AGCTGCATCTGAGCTTGAGCGTACAAAATTAAAAGATAAAAAATTCATTAATGTCGATTTAGATAATATT
GATGAAGTAATGGAATCTCTGTCTCCAAGAGCTGCTTTTCAAGTAGACAATACGTTGACAGAAGAAGGCG
GTAAAATGGCAGTTGATTTAACGTTTAAGTCAATGGAAGATTTTCGCCCGGAAAATGTTGTACAGCAAGT
TGATCCATTAAAGAAATTGGTTGAGGCGCGTGAGCGTTTAACCGATTTAAGAAACAAAATTTCAAACAGT
GAGCGTTTAGAAGATCTGCTTGATGAGGTTCTTAAAAATACTGATCAAATCCGTAAATTAAGTGCCGAGG
CCGATCATGAATAA