SecReT6
Protein ID: 384142701
SecReT6 ID585
T6SS typei4b
Gene symbol-
Locus tagABZJ_01455
StrainAcinetobacter baumannii MDR-ZJ06
Repliconchromosome [GenBank: NC_017171] [Browse all T6SS(s) in this replicon]
Location [Strand]1508544..1510040 [+]
Producthypothetical protein
NoteTssC
UniProt IDG2JH65
KEGG IDabz:ABZJ_01455
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 8.90E-192, Aligned region: 70..494
Protein Sequence: 498 a.a.     [Download]
>gi|384142701|ref|YP_005525411.1| hypothetical protein [Acinetobacter baumannii MDR-ZJ06]
MPRPIMNNTQSAAMPLVENEEVNLLDSIVEQSRIARNEEEHSRAKSLIGELAKEVMAGTITVSENMTLSI
DKRIAEIDALISKQLSQIMHNEQFQKIESTWRGLYYFCQETPSNPLIKIRMLNTTKKELVKDFQGATDFD
QSTLFKKIYEEEYGSFGGAPYSALIGDFEFDRTPSDMYLLEQISHVAAAAHAPFISAASPSILGLESFTD
IDRPRDVSKIFETAEYVQWRSFRDSEDSRYVALTLPHVLGRLPYHPKEGTATEGFNFIEDVSGENHNEYL
WMNAAYAFGTRLTNAFDMHGWCAAIRGVEGGGLVEGLPVHTFKTQDGEVVFKCPTEIAITDRREKELSDL
GFIPLVHCKNTDYAAFFGAQSTQKPKKYDNDTANANSALSSQIQYIMAVSRIAHYLKAMMRDKVGSFASA
GNVEAFLNEWLSQYVLLDDGASQEAKAQYPLREASVKVVEDPAQPGHYKSVVFLRPHFQLDELSVSLRLV
TELPQSSN
 
Nucleotide Sequence: 1497 bp     [Download]
>gi|384141246|ref|NC_017171.1|:1508544-1510040 Acinetobacter baumannii MDR-ZJ06 chromosome, complete genome
GTGCCGAGGCCGATCATGAATAATACTCAATCAGCAGCAATGCCACTTGTTGAAAATGAAGAAGTTAATC
TTTTAGATTCGATTGTTGAACAAAGCCGTATTGCACGAAATGAAGAAGAACATTCTCGTGCTAAAAGCTT
AATTGGTGAGCTTGCTAAAGAAGTAATGGCAGGGACCATTACTGTTTCTGAAAATATGACTTTATCAATT
GATAAGCGTATTGCAGAAATTGATGCTCTGATTTCAAAGCAGTTAAGTCAGATCATGCACAATGAACAAT
TCCAAAAAATTGAGTCAACTTGGCGTGGTCTTTATTACTTTTGTCAGGAAACGCCTTCAAATCCGCTCAT
TAAAATTCGTATGCTTAATACGACTAAGAAAGAGTTGGTAAAAGATTTCCAAGGTGCTACAGACTTTGAT
CAAAGCACTTTGTTTAAGAAAATCTACGAAGAAGAATACGGTTCTTTTGGTGGTGCACCATACTCAGCAT
TAATTGGTGATTTTGAGTTTGATCGTACTCCATCTGATATGTATTTGCTTGAGCAAATCTCTCATGTTGC
AGCGGCAGCACATGCACCATTTATTTCAGCTGCTAGTCCGAGCATTTTAGGCCTTGAATCATTTACAGAT
ATTGATCGTCCTAGAGATGTTTCAAAAATCTTTGAAACCGCTGAATATGTTCAATGGCGTTCGTTCCGTG
ATAGTGAAGACTCACGTTATGTTGCATTGACTTTGCCTCATGTCTTGGGTCGTCTCCCATATCATCCAAA
AGAAGGTACTGCGACAGAAGGCTTTAATTTTATTGAAGATGTTTCTGGTGAAAACCACAATGAATATTTG
TGGATGAATGCAGCTTATGCTTTTGGTACTCGCTTAACAAATGCATTTGATATGCATGGTTGGTGTGCTG
CTATTCGCGGTGTTGAAGGTGGTGGTTTAGTTGAAGGCTTGCCAGTACATACTTTTAAAACACAAGATGG
CGAAGTGGTATTCAAGTGTCCAACTGAAATTGCAATCACGGATCGCCGTGAAAAAGAGTTAAGCGATCTA
GGCTTCATTCCGTTAGTACATTGTAAAAATACAGATTACGCAGCTTTCTTTGGCGCGCAATCAACTCAAA
AACCTAAAAAATATGACAATGATACAGCCAATGCAAACTCGGCTTTATCAAGTCAGATTCAGTACATCAT
GGCTGTTTCACGTATTGCACATTACTTAAAAGCAATGATGCGAGATAAAGTGGGTAGCTTTGCTTCTGCT
GGAAATGTTGAAGCATTCTTAAATGAGTGGTTGTCACAGTATGTCTTACTTGACGATGGTGCTTCTCAAG
AAGCAAAAGCTCAATACCCGTTACGTGAAGCGTCTGTAAAAGTTGTAGAAGATCCTGCTCAACCAGGTCA
CTACAAATCTGTGGTTTTCTTGCGACCACATTTCCAGCTGGATGAGTTGTCGGTTTCTTTACGACTTGTC
ACTGAGTTACCTCAGTCCTCAAATTAA