SecReT6
Protein ID: 384142704
SecReT6 ID585
T6SS typei4b
Gene symbol-
Locus tagABZJ_01458
StrainAcinetobacter baumannii MDR-ZJ06
Repliconchromosome [GenBank: NC_017171] [Browse all T6SS(s) in this replicon]
Location [Strand]1511166..1512977 [+]
Producthypothetical protein
NoteTssF
UniProt IDG2JH68
KEGG IDabz:ABZJ_01458
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 9.90E-156, Aligned region: 5..603
Protein Sequence: 603 a.a.     [Download]
>gi|384142704|ref|YP_005525414.1| hypothetical protein [Acinetobacter baumannii MDR-ZJ06]
MIEELLPFYEKQLQEFGQQSREFAQKYPKIAQRLSLNQEQIDDPHIERLIQAFSLIAARIDKKLTDSYDV
FTRSLFEVMFPQYLRHFPACSVVSFEDINKIKQLTEPHLVPHHTVLKSRSFKGVQCEFNTTQEVKLLPIH
LSGLDFKTTPSAHMHLNQNATLSLKFEIFNNAHACLTDEKLPIYLDAISNFPLQVLDSIFKKGTSFAVKY
GQTIVELSKNPFELIGFAEQESLLPLDQHTHHAYRLLMEYFCFPEKFSYLKLDLDFLRRLPQHVSEFELL
IHFKLNLNDQAVVRNYSELNIANFKLFTTPVINLFEKYAEPQKIVHKQLEYPLVTDAHHPEFYQVYSILE
MNMVREKTNQEESYVPVLPFFAMSHYHNDTARFFYSVNYQKLQSNFVEMGYSIISKNLNPFSTRSDFIST
KLLCSNRDLPHEALGQSNNVLNLNDSSLARRAIVLKRPTKPYKFEQGQSEQWRVISHLSLNSLALMKGDA
VSHVKELLALYNLPQSKENYLIIESIKKLEFSLTHKLVDGKPFPMFVRGVKAELQIDSSVFRGHSLYIFS
QLLSRVFNLKVQINSFVDLVVKDYSSQQELYQCSQNVGGKTLL
 
Nucleotide Sequence: 1812 bp     [Download]
>gi|384141246|ref|NC_017171.1|:1511166-1512977 Acinetobacter baumannii MDR-ZJ06 chromosome, complete genome
GTGATAGAAGAGCTTTTACCGTTTTATGAAAAACAATTACAAGAATTTGGTCAACAATCTCGAGAATTTG
CCCAAAAATATCCAAAAATTGCTCAGCGCTTATCTTTAAATCAAGAGCAAATTGATGACCCACATATTGA
ACGTCTGATTCAGGCTTTTTCGCTGATTGCTGCTCGAATCGATAAAAAACTAACAGACAGTTACGATGTT
TTTACTCGTTCTTTATTTGAGGTGATGTTCCCTCAATACTTACGGCATTTTCCTGCGTGTTCAGTTGTTA
GCTTTGAAGATATTAATAAGATTAAACAGCTTACAGAACCTCATCTTGTACCTCATCATACGGTTTTGAA
ATCTCGTAGTTTCAAAGGAGTACAGTGTGAGTTTAATACAACTCAAGAGGTTAAATTACTACCTATTCAT
TTAAGTGGTTTAGATTTTAAAACTACACCTAGTGCACATATGCACTTAAATCAAAATGCGACGTTGAGCC
TTAAATTTGAAATTTTTAATAATGCTCATGCTTGTTTAACTGATGAGAAGCTTCCTATTTATTTGGATGC
TATCTCTAATTTTCCTCTACAGGTCCTTGATAGTATTTTCAAAAAAGGAACCAGTTTTGCGGTTAAATAT
GGACAAACAATTGTAGAATTGAGCAAGAATCCATTTGAATTGATTGGTTTTGCAGAACAAGAAAGTTTAT
TACCGCTTGATCAACATACCCATCATGCTTATCGTTTGTTGATGGAATACTTTTGTTTCCCGGAAAAGTT
TAGTTATCTTAAGCTCGATTTGGATTTTTTAAGGCGACTACCTCAGCATGTATCCGAATTTGAGCTTTTA
ATTCATTTCAAATTAAACTTAAATGATCAAGCCGTTGTTAGAAACTATTCTGAGCTAAATATTGCAAACT
TTAAATTATTTACTACCCCCGTAATTAATTTATTTGAAAAATATGCTGAACCCCAGAAGATAGTTCACAA
GCAATTAGAATATCCTTTAGTTACAGACGCTCACCATCCTGAATTTTATCAAGTATATTCAATACTTGAG
ATGAATATGGTGCGTGAAAAAACAAATCAGGAAGAAAGCTATGTTCCTGTTTTGCCTTTTTTTGCGATGA
GCCATTACCACAATGATACAGCTCGCTTTTTTTACTCAGTAAACTATCAAAAGTTACAGTCCAATTTCGT
TGAAATGGGCTATTCGATTATTTCTAAAAATTTAAATCCATTTTCAACGCGCTCAGATTTTATTAGCACT
AAATTATTATGTTCAAACCGTGATTTACCTCATGAAGCACTGGGTCAGTCTAATAACGTATTAAATTTAA
ATGATAGTAGCTTGGCGAGACGTGCCATTGTTTTAAAACGACCTACAAAGCCTTATAAGTTTGAACAAGG
CCAAAGTGAACAGTGGCGTGTGATCTCGCATCTTTCATTAAATAGCTTAGCACTTATGAAAGGGGATGCT
GTTTCTCATGTTAAAGAGCTGCTGGCTTTATATAACTTACCGCAGTCAAAAGAAAACTATTTAATTATAG
AATCAATTAAAAAATTAGAATTTTCTCTTACCCATAAACTCGTAGATGGCAAACCATTTCCAATGTTTGT
AAGAGGAGTAAAAGCTGAATTACAAATTGATTCATCCGTATTTAGAGGGCATAGCTTATATATTTTTAGT
CAGTTATTAAGTCGTGTTTTTAATTTAAAGGTTCAAATTAATAGTTTTGTTGATTTGGTGGTTAAGGATT
ATTCATCTCAGCAGGAGTTATACCAATGCAGTCAGAACGTTGGTGGCAAGACTCTTCTGTAA