SecReT6
Protein ID: 384142714
SecReT6 ID585
T6SS typei4b
Gene symbol-
Locus tagABZJ_01468
StrainAcinetobacter baumannii MDR-ZJ06
Repliconchromosome [GenBank: NC_017171] [Browse all T6SS(s) in this replicon]
Location [Strand]1526668..1527474 [+]
Producthypothetical protein
NoteTssL
UniProt IDG2JH78
KEGG IDabz:ABZJ_01468
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.10E-52, Aligned region: 34..239
Protein Sequence: 268 a.a.     [Download]
>gi|384142714|ref|YP_005525424.1| hypothetical protein [Acinetobacter baumannii MDR-ZJ06]
MSQSTGAPSLFDDGQIGTGGNNNSQSQVKLQAINLIDLLHDGFYLIFLIRNQYVPADPQRFREKILDLLN
RFEQQAKKLQFSADDIHDAKYAFCALIDETIVTQQDPSYFNLQNSWLISPLQLSLFGSQLAGYQFFEILE
QLRSRGKDRLAALEVFHYCLLLGFQGKYRIESIESLNHLVARVGDEIDYLKGKKVAFSPFSAIPDQIRNI
IHRELPFFWILIFLLIFALLTFAGLRFMLNNQNDKALSNYQNVISAPQEQAHITIYLP
 
Nucleotide Sequence: 807 bp     [Download]
>gi|384141246|ref|NC_017171.1|:1526668-1527474 Acinetobacter baumannii MDR-ZJ06 chromosome, complete genome
ATGTCACAATCTACAGGTGCTCCTTCTTTATTTGACGATGGGCAAATTGGGACAGGGGGGAACAATAATA
GCCAGTCCCAAGTAAAATTACAGGCAATTAATCTGATTGATTTATTGCATGATGGTTTTTACTTAATCTT
TTTAATTCGAAATCAGTATGTGCCAGCTGATCCACAGCGCTTTCGTGAAAAAATTCTAGATTTGCTTAAT
CGATTTGAGCAACAAGCGAAAAAGTTACAATTTTCAGCTGATGATATTCATGATGCTAAATATGCGTTTT
GTGCGCTAATTGATGAAACGATCGTAACCCAGCAAGACCCAAGCTATTTTAATTTACAAAATTCTTGGTT
AATTAGTCCATTACAGTTAAGCCTGTTTGGTTCACAGTTAGCGGGTTATCAATTCTTCGAAATTTTAGAG
CAACTACGTAGTCGTGGAAAAGATCGATTAGCTGCTCTTGAAGTCTTCCATTACTGCTTATTATTAGGTT
TTCAGGGTAAATACCGAATTGAGTCAATTGAAAGCCTTAACCATTTGGTGGCACGAGTAGGCGATGAAAT
TGATTATCTGAAAGGGAAAAAAGTGGCTTTTTCGCCATTCTCGGCAATTCCTGATCAGATACGAAATATT
ATCCATCGTGAGTTACCTTTTTTCTGGATTTTGATTTTCTTATTGATTTTTGCATTACTTACCTTTGCAG
GTTTAAGATTTATGCTTAACAATCAAAATGATAAAGCATTATCTAATTATCAAAATGTGATTTCTGCCCC
ACAAGAGCAGGCACATATTACAATTTACTTACCTTGA