SecReT6
Protein ID: 384172995
SecReT6 ID586
T6SS typei1
Gene symbol-
Locus tagABLL_2180
StrainArcobacter sp. L
Repliconchromosome [GenBank: NC_017192] [Browse all T6SS(s) in this replicon]
Location [Strand]2233788..2234642 [-]
Producthypothetical protein
NoteTssL
UniProt IDG2HY52
KEGG IDarc:ABLL_2180
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.80E-47, Aligned region: 50..253
Protein Sequence: 284 a.a.     [Download]
>gi|384172995|ref|YP_005554372.1| hypothetical protein [Arcobacter sp. L]
MNNSTVLISKDVNKQKITNFKKENSFSEFKNKAIYKNDIKEKDFQNVSFNPFLLVATPLIESVLELKENS
KELNMDDIRDEFIAKINTFNELAVENKIENMEILVARYILCTFIDEIVNSTFSNNDSWFNKSLLNIFHNE
TYGGENFFHLMDKFLKTPAKYINILELMYICLSLGFLGKYRVVDRGEMEINNIKDSLYKQIKIVQGRDPI
KFYTKVEPIKRRYKLFNKISYPLLLTFIFLLLTTFFIFLSYRLYEKNENFLNLINNISNTNIQKNIEETK
NDKF
 
Nucleotide Sequence: 855 bp     [Download]
>gi|384170815|ref|NC_017192.1|:c2234642-2233788 Arcobacter sp. L, complete genome
ATGAATAATAGTACAGTATTAATTTCAAAAGATGTTAATAAACAAAAAATAACAAATTTCAAAAAAGAAA
ATAGTTTTAGTGAATTTAAAAACAAAGCAATATATAAAAATGATATAAAAGAAAAAGATTTTCAAAATGT
ATCGTTTAATCCATTTTTATTAGTTGCAACTCCCTTAATAGAATCTGTTTTAGAATTAAAAGAAAATTCA
AAAGAATTAAATATGGATGATATAAGAGATGAATTTATTGCAAAAATAAATACTTTTAATGAGTTGGCAG
TTGAAAATAAAATAGAAAATATGGAAATATTAGTAGCAAGATATATTTTATGTACATTTATTGATGAGAT
TGTAAATAGTACATTTTCAAATAATGATAGTTGGTTTAATAAAAGTTTATTAAATATATTCCACAATGAA
ACTTATGGTGGAGAAAACTTTTTTCACTTAATGGATAAATTTTTAAAAACACCTGCAAAATATATAAATA
TATTAGAACTTATGTATATTTGTTTATCTTTAGGATTTCTTGGTAAATATCGAGTGGTAGATAGAGGTGA
AATGGAAATAAATAATATAAAAGATAGTCTCTATAAACAAATAAAAATTGTCCAAGGAAGAGATCCTATC
AAATTTTATACTAAAGTTGAACCAATAAAAAGAAGATATAAACTTTTTAATAAAATATCTTATCCTTTAT
TACTCACTTTTATTTTCTTATTATTAACTACTTTTTTCATATTTTTAAGTTATAGATTATATGAGAAAAA
TGAAAATTTTTTAAATTTAATTAATAATATTTCAAATACTAACATTCAGAAAAATATAGAGGAAACAAAA
AATGATAAATTTTAA