SecReT6
Protein ID: 384172996
SecReT6 ID586
T6SS typei1
Gene symbol-
Locus tagABLL_2181
StrainArcobacter sp. L
Repliconchromosome [GenBank: NC_017192] [Browse all T6SS(s) in this replicon]
Location [Strand]2234653..2235981 [-]
Producthypothetical protein
NoteTssK
UniProt IDG2HY53
KEGG IDarc:ABLL_2181
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.20E-111, Aligned region: 17..440
Protein Sequence: 442 a.a.     [Download]
>gi|384172996|ref|YP_005554373.1| hypothetical protein [Arcobacter sp. L]
MENRVVWREGLFIKPQHFQQNDRYFTYELAQRTSMSRENNWGFYNLQIDEHLLSTGKLLITKASGLLFDG
TYFEINSENNSLILDIKSNYLNKVVYLALPINIKNSDEVYFEEQKNMQTRLKARTIENIPNINSGETSIS
DILIAEYNFRLLFEDDLDARFIYLPICKIADISLNGTISLDNDFLPTYLDIQVANKLYTQTKEILEIIGF
RAEKLSQKVTDSVMKNTQIGDYLLLQLLNKYESRIHYLLTQNRIHPDKIFIDLVSLTSELAVFMKKEKRL
LNQFNYNHNEQYESFKRLFDELKNMLTMVLEQNSISLQIEKRKYGIHIVPIQDKELIKNSYFIFSVSADI
SADKIKEILINGLKFGTVENIKNLVNYHLIGFKIKPLATAPKEIPYKVNHLYFKLELTEENLKELLKSAA
FAFHLSTEIPNVEYALWAIKNN
 
Nucleotide Sequence: 1329 bp     [Download]
>gi|384170815|ref|NC_017192.1|:c2235981-2234653 Arcobacter sp. L, complete genome
ATGGAAAATAGAGTAGTTTGGAGAGAAGGACTTTTTATAAAACCACAACATTTCCAACAAAATGATAGAT
ATTTTACTTATGAATTAGCTCAAAGAACTTCAATGTCTAGAGAAAATAATTGGGGATTTTATAATTTACA
AATTGATGAACATCTTTTATCTACAGGTAAATTACTTATAACAAAAGCTTCTGGATTGTTGTTTGATGGA
ACTTATTTTGAGATTAATTCAGAAAATAATAGTTTAATTTTAGATATTAAAAGTAATTATTTAAATAAAG
TTGTATATTTGGCTTTGCCTATAAATATAAAAAACAGTGATGAGGTATATTTTGAGGAACAAAAAAATAT
GCAAACTAGACTTAAAGCAAGAACGATTGAAAATATTCCAAATATAAATTCAGGTGAAACGAGTATTAGT
GATATTCTAATTGCAGAATATAACTTTAGATTACTTTTTGAAGATGATTTAGATGCAAGATTTATATATT
TACCTATTTGTAAAATTGCAGATATTTCACTTAATGGAACAATATCTTTAGATAATGATTTTTTACCTAC
TTATTTAGATATACAAGTTGCTAATAAGCTATATACTCAAACTAAAGAAATTCTAGAAATTATTGGTTTT
AGAGCTGAAAAATTATCACAAAAAGTAACTGATTCTGTTATGAAGAATACTCAAATTGGAGATTATCTTT
TACTTCAACTTCTAAATAAATATGAAAGTCGAATACATTATTTATTAACACAAAATAGAATTCATCCTGA
TAAAATATTTATTGATTTAGTATCTTTAACAAGTGAGTTGGCTGTTTTTATGAAGAAAGAGAAAAGGTTA
TTAAATCAATTTAATTATAATCATAATGAACAGTATGAAAGTTTTAAAAGATTGTTTGACGAATTAAAAA
ATATGTTAACAATGGTACTAGAACAAAATAGTATATCTTTACAAATTGAAAAAAGAAAATATGGAATACA
TATTGTTCCTATTCAAGATAAAGAACTAATCAAAAATTCGTATTTTATTTTCTCTGTTTCAGCTGATATT
AGTGCTGATAAAATTAAAGAAATTTTGATAAATGGATTGAAATTTGGGACAGTTGAAAATATAAAAAATT
TGGTTAATTATCATCTTATAGGCTTTAAAATCAAGCCTTTAGCAACAGCTCCCAAAGAGATTCCTTATAA
AGTTAATCATTTATATTTTAAATTAGAGTTAACAGAAGAAAACCTAAAAGAGTTATTAAAATCTGCTGCA
TTTGCATTTCACTTATCTACTGAAATTCCAAATGTAGAATATGCTTTATGGGCAATAAAAAATAATTAA