SecReT6
Protein ID: 384172997
SecReT6 ID586
T6SS typei1
Gene symbol-
Locus tagABLL_2182
StrainArcobacter sp. L
Repliconchromosome [GenBank: NC_017192] [Browse all T6SS(s) in this replicon]
Location [Strand]2235971..2236432 [-]
Producthypothetical protein
NoteTssJ
UniProt IDG2HY54
KEGG IDarc:ABLL_2182
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.20E-23, Aligned region: 16..133
Protein Sequence: 153 a.a.     [Download]
>gi|384172997|ref|YP_005554374.1| hypothetical protein [Arcobacter sp. L]
MYRNFGRFILILISTFFIIGCAKDPTHLELVLKSGDKLNLDIDDRSSPLMVTFYELESAEKFMKYDYWTI
LDDKESLKNDLISQSKHVILANQLQNYKIAFNDKARYLGILCNFRIIDNDYTWKSVIDLKKSSYNFGEFE
INKFNMQRVDNGK
 
Nucleotide Sequence: 462 bp     [Download]
>gi|384170815|ref|NC_017192.1|:c2236432-2235971 Arcobacter sp. L, complete genome
ATGTATAGGAATTTTGGTAGGTTTATATTAATTTTAATAAGTACATTTTTTATAATTGGGTGTGCAAAAG
ATCCAACACATTTAGAATTGGTATTAAAATCAGGAGATAAACTAAATCTAGATATTGATGATCGTTCTTC
ACCTTTAATGGTCACTTTCTATGAATTAGAATCAGCAGAAAAATTTATGAAATATGATTATTGGACAATA
CTTGATGATAAAGAAAGTTTAAAAAATGATTTGATTTCTCAATCAAAACATGTGATTTTAGCAAATCAAC
TTCAAAACTATAAAATAGCTTTCAATGATAAAGCTAGATATTTAGGTATTTTATGTAATTTTAGAATAAT
AGATAACGATTATACTTGGAAAAGTGTTATTGATTTAAAAAAGAGTTCTTATAATTTTGGAGAGTTTGAA
ATTAATAAATTTAATATGCAAAGAGTAGATAATGGAAAATAG