SecReT6
Protein ID: 384172998
SecReT6 ID586
T6SS typei1
Gene symbol-
Locus tagABLL_2183
StrainArcobacter sp. L
Repliconchromosome [GenBank: NC_017192] [Browse all T6SS(s) in this replicon]
Location [Strand]2236444..2237712 [-]
Producthypothetical protein
NoteFha
UniProt IDG2HY55
KEGG IDarc:ABLL_2183
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 9.00E-11, Aligned region: 26..94
FHA [PF00498], Evalue: 9.00E-11, Aligned region: 134..151
FHA [PF00498], Evalue: 9.00E-11, Aligned region: 381..401
Protein Sequence: 422 a.a.     [Download]
>gi|384172998|ref|YP_005554375.1| hypothetical protein [Arcobacter sp. L]
MQLLFEIINENNRTNNIFRLENKDAIIGRSIQSDWQLYDEMCHISGKHILIEYKDGLYFLTDISTNGTFL
KNPYKKLPKDIPIKINTNDIYIIGNYEIKVKFLEQEASLKSLSSFDYLLNNEKSMNNQMIIPDDDFLLED
SSVMNNSFIKEEKKINTNNFFDIYENNENKIFDILNSSSSLEEENYEDNIPSFDVLNEHLDTSSYKIETM
EEGIECEIEDEIIEIKNSEVNNEILSQLEQRLGIKISKLSKVEQKKVIDEIVDIVLNTITGLRNSLAIKD
KFLSDMNLEKLISNNDDLNPIKKGKNESLMTLLNTSNEVITISQAVKNSFMDLDNHNLVVNSNINFTISN
TIEEFSPENVLNKLDKNSKYKSYLPKKFQIWDLYIKDYENLKSENSEIFNKLKNNYSREYIDLLNSLKTS
KI
 
Nucleotide Sequence: 1269 bp     [Download]
>gi|384170815|ref|NC_017192.1|:c2237712-2236444 Arcobacter sp. L, complete genome
ATGCAATTATTATTTGAAATAATTAATGAAAATAATAGAACAAATAATATTTTTAGATTAGAAAATAAAG
ATGCAATTATTGGTCGTTCTATTCAATCAGATTGGCAGTTGTATGATGAAATGTGTCATATCTCAGGCAA
ACATATTTTAATTGAATATAAAGATGGATTATATTTTTTAACTGATATTAGTACAAATGGAACATTTCTT
AAAAATCCATATAAAAAATTGCCTAAAGATATTCCAATAAAAATAAATACTAATGATATTTATATAATTG
GTAATTATGAAATAAAAGTTAAGTTTTTAGAACAAGAAGCCTCTTTAAAAAGTCTATCTTCTTTTGATTA
TCTTCTTAATAATGAAAAAAGTATGAATAATCAAATGATTATTCCTGATGATGATTTTTTACTTGAAGAT
AGTTCAGTTATGAATAATAGTTTTATAAAAGAAGAAAAAAAAATAAATACAAATAATTTCTTTGATATTT
ATGAAAACAATGAAAATAAAATATTTGATATATTAAATTCTAGTAGTTCTTTAGAAGAAGAAAATTATGA
AGATAATATTCCAAGTTTTGATGTATTAAATGAACATTTAGATACTTCATCATATAAAATAGAGACAATG
GAAGAAGGAATAGAATGTGAAATTGAAGATGAAATTATTGAAATAAAAAATAGTGAAGTCAATAATGAAA
TTCTTTCTCAACTAGAACAAAGATTAGGTATAAAAATAAGTAAATTATCAAAAGTAGAACAAAAAAAAGT
AATAGATGAAATAGTTGATATTGTTTTAAATACAATTACTGGATTAAGAAATTCTTTGGCAATTAAAGAT
AAATTTTTGTCAGATATGAATTTAGAGAAATTAATTTCAAATAATGATGATTTAAACCCAATAAAAAAAG
GTAAAAATGAATCTTTAATGACTTTATTAAATACATCAAATGAAGTTATTACTATTTCTCAAGCAGTAAA
AAATTCTTTCATGGACTTAGATAATCATAATTTAGTTGTAAATTCTAATATAAATTTTACTATTTCTAAT
ACAATAGAAGAATTTTCTCCTGAAAATGTTCTTAATAAATTAGATAAAAATTCTAAATATAAATCATATC
TACCAAAAAAATTCCAAATATGGGATTTATATATCAAAGACTATGAAAATCTAAAAAGTGAAAATAGTGA
AATTTTCAATAAACTTAAAAATAACTATTCAAGAGAATATATTGATTTATTGAATAGTTTAAAAACATCA
AAAATATAG