SecReT6
Protein ID: 384173000
SecReT6 ID586
T6SS typei1
Gene symbol-
Locus tagABLL_2185
StrainArcobacter sp. L
Repliconchromosome [GenBank: NC_017192] [Browse all T6SS(s) in this replicon]
Location [Strand]2237925..2240363 [-]
ProductATPase
NoteTssH
UniProt IDG2HY57
KEGG IDarc:ABLL_2185
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.70E-42, Aligned region: 211..257
AAA_2 [PF07724], Evalue: 2.70E-42, Aligned region: 473..506
AAA_2 [PF07724], Evalue: 2.70E-42, Aligned region: 548..713
AAA [PF00004], Evalue: 9.30E-23, Aligned region: 128..168
AAA [PF00004], Evalue: 9.30E-23, Aligned region: 213..325
AAA [PF00004], Evalue: 9.30E-23, Aligned region: 553..679
AAA_5 [PF07728], Evalue: 4.10E-15, Aligned region: 213..235
AAA_5 [PF07728], Evalue: 4.10E-15, Aligned region: 552..669
ClpB_D2-small [PF10431], Evalue: 7.70E-14, Aligned region: 719..793
AAA_16 [PF13191], Evalue: 3.40E-12, Aligned region: 191..230
AAA_16 [PF13191], Evalue: 3.40E-12, Aligned region: 258..298
AAA_16 [PF13191], Evalue: 3.40E-12, Aligned region: 545..584
AAA_16 [PF13191], Evalue: 3.40E-12, Aligned region: 623..648
AAA_22 [PF13401], Evalue: 7.00E-09, Aligned region: 212..308
AAA_22 [PF13401], Evalue: 7.00E-09, Aligned region: 336..373
AAA_22 [PF13401], Evalue: 7.00E-09, Aligned region: 550..647
IstB_IS21 [PF01695], Evalue: 2.00E-07, Aligned region: 5..58
IstB_IS21 [PF01695], Evalue: 2.00E-07, Aligned region: 194..273
IstB_IS21 [PF01695], Evalue: 2.00E-07, Aligned region: 552..569
Sigma54_activat [PF00158], Evalue: 2.70E-06, Aligned region: 209..230
Sigma54_activat [PF00158], Evalue: 2.70E-06, Aligned region: 549..651
AAA_17 [PF13207], Evalue: 2.00E-05, Aligned region: 213..290
AAA_17 [PF13207], Evalue: 2.00E-05, Aligned region: 551..587
NACHT [PF05729], Evalue: 2.20E-05, Aligned region: 213..241
NACHT [PF05729], Evalue: 2.20E-05, Aligned region: 406..445
NACHT [PF05729], Evalue: 2.20E-05, Aligned region: 552..577
AAA_19 [PF13245], Evalue: 4.50E-05, Aligned region: 210..234
AAA_19 [PF13245], Evalue: 4.50E-05, Aligned region: 548..574
MobB [PF03205], Evalue: 0.00041, Aligned region: 214..238
MobB [PF03205], Evalue: 0.00041, Aligned region: 551..583
DEAD [PF00270], Evalue: 0.00047, Aligned region: 139..157
DEAD [PF00270], Evalue: 0.00047, Aligned region: 199..237
DEAD [PF00270], Evalue: 0.00047, Aligned region: 268..302
DEAD [PF00270], Evalue: 0.00047, Aligned region: 552..583
Zeta_toxin [PF06414], Evalue: 0.00054, Aligned region: 213..230
Zeta_toxin [PF06414], Evalue: 0.00054, Aligned region: 550..593
RNA_helicase [PF00910], Evalue: 0.00071, Aligned region: 214..237
RNA_helicase [PF00910], Evalue: 0.00071, Aligned region: 553..574
NB-ARC [PF00931], Evalue: 0.00077, Aligned region: 193..227
NB-ARC [PF00931], Evalue: 0.00077, Aligned region: 542..570
AAA_29 [PF13555], Evalue: 0.0011, Aligned region: 205..225
AAA_29 [PF13555], Evalue: 0.0011, Aligned region: 547..577
SRP54 [PF00448], Evalue: 0.0012, Aligned region: 213..237
SRP54 [PF00448], Evalue: 0.0012, Aligned region: 551..576
DUF258 [PF03193], Evalue: 0.0024, Aligned region: 199..229
DUF258 [PF03193], Evalue: 0.0024, Aligned region: 528..564
PhoH [PF02562], Evalue: 0.0025, Aligned region: 202..241
PhoH [PF02562], Evalue: 0.0025, Aligned region: 549..577
RuvB_N [PF05496], Evalue: 0.0027, Aligned region: 265..292
RuvB_N [PF05496], Evalue: 0.0027, Aligned region: 518..573
RuvB_N [PF05496], Evalue: 0.0027, Aligned region: 618..643
AAA_10 [PF12846], Evalue: 0.005, Aligned region: 47..110
AAA_10 [PF12846], Evalue: 0.005, Aligned region: 276..300
AAA_10 [PF12846], Evalue: 0.005, Aligned region: 549..646
T2SE [PF00437], Evalue: 0.0051, Aligned region: 175..236
T2SE [PF00437], Evalue: 0.0051, Aligned region: 547..630
AAA_25 [PF13481], Evalue: 0.0052, Aligned region: 213..237
AAA_25 [PF13481], Evalue: 0.0052, Aligned region: 269..310
AAA_25 [PF13481], Evalue: 0.0052, Aligned region: 548..566
AAA_30 [PF13604], Evalue: 0.0053, Aligned region: 211..230
AAA_30 [PF13604], Evalue: 0.0053, Aligned region: 547..575
AAA_33 [PF13671], Evalue: 0.0055, Aligned region: 213..230
AAA_33 [PF13671], Evalue: 0.0055, Aligned region: 551..572
Mg_chelatase [PF01078], Evalue: 0.0057, Aligned region: 211..250
Mg_chelatase [PF01078], Evalue: 0.0057, Aligned region: 551..575
Mg_chelatase [PF01078], Evalue: 0.0057, Aligned region: 624..651
DUF2075 [PF09848], Evalue: 0.0089, Aligned region: 136..179
DUF2075 [PF09848], Evalue: 0.0089, Aligned region: 215..315
DUF2075 [PF09848], Evalue: 0.0089, Aligned region: 452..452
Protein Sequence: 812 a.a.     [Download]
>gi|384173000|ref|YP_005554377.1| ATPase [Arcobacter sp. L]
MKIELKELIDALNYRTKNYLEKAAQRTIERMGNEIIVEDLFYAMLLEEESLLFKIIDQYNLNLKEFQNII
ENSSKLSITESTNPVFSNMLIQLLEDSYFYSIFNFSSKDITENSLVLSFFENIYKYSKTKYFTIFKDVNY
DELKKLILTEKDTLDKKATQSKSTREKTSLLEQYTVNLTNLAKEEKLDSVLCREDEISQVIDILLRRRKN
NPILVGEAGVGKTAVAEGLAIKIIKKQVPKELYYAEILSLDMGILQAGASVKGEFEKRLQGIIKEIQSSS
KFIILFIDEAHTLIGSGNSEGSSDAANLLKPALSRGELRTLAATTWLEYRKYFEKDAALSRRFQKVNIFE
PSVEETTTILRGLSKKYEESHNVYIEDEALFSASFLSARYINGRQLPDKAIDVLDTACTNVKIMRTNLPK
DLQVIEVQLEEKNRELESLSRDNDNSIKDYKKEIKKLELEIKNLKNKYKKIEEQKTDSSPNVTKEDIAKV
VSSWTGIPLGNMIQEQMKNILNLSENLKKRVIGQEKSVEFLSKFLQVSIAGLKKENSPNGVFLLVGPSGV
GKTETARSVAELLYGSERFLTVINMTEFQEKHAISRLIGSPPGYVGYSEGGQLTDFVRIRPYSVVLLDEI
EKAHPDILNLFYQIFDRGEVSDSEGRIIDFKNTIIFLTSNLATEIITELCLTKTEYSLDEINEYITPTLS
NYLKAALLGRMNVVPFLNLKEEALKQIVELKFSSIKKQLHKRDISLKIEDSLLNHIVSISNTIDTGARNI
DYIINMNVLPKISNYIINASLNKTKIKYIDVSLDNNLNIIIK
 
Nucleotide Sequence: 2439 bp     [Download]
>gi|384170815|ref|NC_017192.1|:c2240363-2237925 Arcobacter sp. L, complete genome
ATGAAAATTGAATTAAAAGAATTAATTGATGCATTAAATTATAGAACAAAAAATTATTTAGAAAAAGCAG
CACAAAGAACAATCGAAAGAATGGGAAATGAAATTATTGTTGAAGATTTATTTTATGCAATGCTTTTAGA
AGAGGAGAGTTTACTTTTTAAAATAATAGATCAATATAATTTAAATTTAAAAGAATTTCAGAATATTATA
GAAAATAGTTCTAAATTATCAATAACAGAAAGTACAAATCCAGTATTTTCCAACATGTTAATACAACTTC
TTGAAGATTCTTATTTTTATTCAATTTTTAATTTTTCATCTAAAGATATTACAGAAAATTCTCTAGTATT
ATCATTTTTTGAGAATATTTATAAATATTCTAAAACAAAATATTTTACTATCTTCAAAGATGTCAATTAT
GATGAATTAAAAAAATTAATCCTAACAGAAAAAGATACTTTAGATAAAAAGGCTACTCAAAGTAAAAGCA
CTAGAGAAAAAACATCTTTATTAGAACAATATACTGTAAATCTTACAAATTTAGCAAAAGAAGAAAAGTT
AGATTCAGTTTTATGTAGAGAGGATGAAATAAGTCAAGTTATAGATATTTTATTAAGAAGAAGAAAAAAT
AATCCAATTTTAGTAGGTGAAGCTGGGGTAGGAAAAACAGCAGTAGCTGAAGGTTTAGCAATAAAGATAA
TAAAAAAACAAGTACCTAAAGAGTTATATTATGCAGAAATATTATCTTTAGATATGGGTATCTTACAAGC
AGGTGCTAGTGTTAAAGGTGAATTTGAAAAACGACTTCAAGGTATTATAAAAGAAATTCAATCAAGTAGT
AAGTTTATTATTTTATTTATTGACGAAGCCCATACTTTGATTGGCTCTGGTAATAGTGAAGGCAGTTCAG
ATGCTGCGAATCTTTTAAAACCTGCTTTATCAAGAGGAGAACTAAGAACTTTAGCTGCAACTACTTGGCT
TGAATATAGAAAATATTTTGAAAAAGATGCTGCACTTTCAAGAAGATTCCAAAAAGTAAATATCTTTGAA
CCATCAGTTGAAGAAACAACGACAATATTAAGAGGATTATCAAAAAAATATGAAGAATCACATAATGTGT
ATATTGAAGATGAAGCTTTATTTAGTGCTTCATTTTTATCTGCAAGATATATAAATGGTAGGCAATTGCC
AGATAAAGCAATAGATGTTTTAGATACAGCTTGTACAAATGTAAAGATTATGAGAACAAATCTTCCTAAA
GATTTACAAGTTATAGAAGTTCAACTTGAAGAAAAAAATAGAGAGTTAGAAAGTTTATCAAGAGATAATG
ATAATAGTATAAAAGATTATAAAAAAGAAATTAAAAAATTAGAACTTGAAATCAAAAATCTAAAAAACAA
ATATAAAAAAATAGAAGAACAAAAAACTGATTCTTCTCCAAATGTTACAAAAGAAGATATTGCAAAAGTA
GTTTCATCTTGGACAGGAATTCCTTTAGGAAATATGATTCAAGAGCAGATGAAAAATATTTTAAATTTAT
CAGAAAATTTAAAAAAAAGAGTTATAGGACAAGAAAAATCAGTTGAATTTTTAAGTAAATTCCTACAAGT
CTCAATTGCTGGTTTAAAAAAAGAAAATTCTCCTAATGGAGTTTTCCTTCTTGTTGGACCAAGTGGTGTA
GGAAAAACAGAAACAGCAAGATCTGTAGCAGAATTATTATATGGAAGTGAAAGATTTCTAACTGTAATTA
ATATGACAGAATTTCAAGAAAAACACGCAATTTCAAGATTAATTGGTTCTCCTCCTGGATATGTTGGGTA
TTCTGAAGGAGGGCAATTAACAGATTTTGTAAGGATAAGACCATATAGTGTTGTTTTATTGGATGAAATA
GAAAAAGCACATCCTGATATTTTAAATTTATTTTATCAAATTTTTGATAGAGGTGAAGTATCTGATTCAG
AAGGACGAATTATAGATTTCAAAAATACAATAATTTTTTTGACTTCAAATTTAGCTACAGAAATAATTAC
AGAATTATGTCTAACTAAAACAGAATATTCATTGGATGAAATAAATGAGTATATTACTCCAACTTTAAGT
AATTATTTAAAAGCAGCATTATTAGGAAGAATGAATGTTGTTCCATTTTTAAATTTAAAAGAAGAAGCTT
TAAAACAAATAGTTGAATTAAAATTTAGTAGTATAAAAAAACAATTACATAAACGAGATATTAGTTTAAA
AATAGAAGATTCTTTATTAAATCATATTGTTTCCATATCAAATACTATAGATACGGGTGCAAGAAATATA
GATTATATAATTAATATGAATGTATTACCAAAAATATCAAATTATATTATTAATGCAAGTTTAAATAAAA
CTAAAATCAAATATATAGATGTTTCTTTAGATAATAATTTAAATATAATAATAAAATGA