SecReT6
Protein ID: 384173001
SecReT6 ID586
T6SS typei1
Gene symbol-
Locus tagABLL_2186
StrainArcobacter sp. L
Repliconchromosome [GenBank: NC_017192] [Browse all T6SS(s) in this replicon]
Location [Strand]2240353..2241345 [-]
Producthypothetical protein
NoteTssG
UniProt IDG2HY58
KEGG IDarc:ABLL_2186
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 6.10E-59, Aligned region: 40..312
Protein Sequence: 330 a.a.     [Download]
>gi|384173001|ref|YP_005554378.1| hypothetical protein [Arcobacter sp. L]
MTLEEINKRINKDITKMDLPQSIRAIIVYLKMYHPNEIEENLYKKIIFKSNHSLSFPKSEVNYVNFIDLQ
NGVEVEVTLNFLSIFGSSSPLPTHYSEMVLSSFDSDKILYDFLNLFNHHLQKFIYPIWEKHRYYVQYKQD
LSDRFSKYILSFLGLYTNTENSLLNFSKLIPFLGILMMKNKSSSTLETILKHYLNHENIEIIQCIKEKYI
IPSFQNSLLGFNNSSLGQDFLIGEYVISRNNKFRIVLKDVDYEDLLKYSILGEKSKELDELIFFCIRDLF
SYELVLNIKKENKKKFILSNNNNYLGINLWLGNSSVDEDILVIKKEKYEN
 
Nucleotide Sequence: 993 bp     [Download]
>gi|384170815|ref|NC_017192.1|:c2241345-2240353 Arcobacter sp. L, complete genome
ATGACTTTAGAAGAAATAAATAAAAGAATAAATAAAGATATAACTAAGATGGATTTACCTCAATCAATAC
GTGCAATAATTGTATATTTAAAGATGTATCATCCTAATGAAATTGAAGAAAATTTATATAAAAAAATTAT
ATTTAAATCAAATCATAGTTTAAGTTTTCCAAAATCAGAAGTTAATTATGTAAATTTTATTGATTTACAA
AACGGTGTGGAAGTAGAAGTTACGTTAAATTTTTTGAGTATTTTTGGCTCATCATCACCACTTCCTACTC
ATTATAGTGAAATGGTTTTATCAAGTTTTGATAGTGATAAAATTTTATATGATTTTTTAAATTTATTTAA
TCATCATCTACAAAAATTTATTTATCCAATATGGGAAAAACATAGATATTATGTTCAATATAAACAAGAT
TTAAGTGACAGATTTTCTAAATATATTTTGTCTTTTTTAGGTTTATATACAAATACAGAAAATAGTTTAT
TGAATTTTTCAAAACTTATTCCTTTTCTTGGTATATTGATGATGAAAAATAAATCATCTTCAACCTTAGA
AACAATTTTAAAACATTATTTAAATCATGAAAATATAGAGATTATTCAATGTATAAAAGAAAAGTATATT
ATACCTTCTTTTCAAAATAGTTTACTTGGTTTTAATAATTCATCTCTTGGTCAAGATTTTTTAATTGGAG
AGTATGTAATAAGTAGAAATAACAAATTTAGAATAGTATTAAAAGATGTTGATTATGAAGACTTACTTAA
ATATAGTATTTTAGGTGAAAAAAGTAAAGAACTTGATGAACTTATATTTTTTTGTATACGAGATTTATTT
AGCTATGAATTAGTTTTAAATATAAAAAAAGAGAATAAAAAAAAATTTATTTTATCGAATAATAACAATT
ATCTAGGAATAAACCTTTGGTTAGGGAACTCAAGTGTCGATGAAGATATATTAGTAATAAAAAAGGAGAA
ATATGAAAATTGA