SecReT6
Protein ID: 384173002
SecReT6 ID586
T6SS typei1
Gene symbol-
Locus tagABLL_2187
StrainArcobacter sp. L
Repliconchromosome [GenBank: NC_017192] [Browse all T6SS(s) in this replicon]
Location [Strand]2241356..2243125 [-]
Producthypothetical protein
NoteTssF
UniProt IDG2HY59
KEGG IDarc:ABLL_2187
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.50E-153, Aligned region: 2..589
Protein Sequence: 589 a.a.     [Download]
>gi|384173002|ref|YP_005554379.1| hypothetical protein [Arcobacter sp. L]
MFNEYYKNELIALRQDGVNFSKKNPGLSFFLSKEGQDPDVERLLEGFAFLTGRLKQQLDQELPELSNTLV
QLLWPNYARVVPSYSVIKYDAVKNGRENIVINKGTEVLSKLKPDTIQCKFKTVYETTIMPFELEKVNYSN
FGQKSSLNLSFKTTNSSTLKDIKFESLRIFLNGSEFLSQDLYLFLMNYVENIEVILKNTENENISKIKID
KNSIKPVGFDSTEYMLPYSANIFEGYILLQEYFCFKDKFLFVDIRNLNLIEKINSDLLFQSNSFEIKIDL
KKTFSFSDTLTKDNFLLYSTPIINLFNSDATPIRKTSTQEEYLVLTSEINREFSEIFQIEKVRGWSDKNK
NYQDFLPFEYFAHSNDDNEHYSIKTKLSLDGTQTNIYVRFSNFSKDNLLSNMNSTISIKTLSTNKNLPSS
LMTGDICVSSYSNAKDETPFKNITIPTRSYPAPIKGDFFWKIISNLSLNYLSLKDIKTLQKILEAYDFIS
IYDKKQKEKTKRILEGLIDIKFETMEFINQGLPIKGIHIKLKLDKNKFSSLGEAYIFSSVLNKFFALYNN
INSFHKLSVDVINEDSFEWPIKMGNQYLI
 
Nucleotide Sequence: 1770 bp     [Download]
>gi|384170815|ref|NC_017192.1|:c2243125-2241356 Arcobacter sp. L, complete genome
ATGTTTAATGAATATTATAAAAATGAATTAATAGCTTTACGACAAGATGGTGTAAATTTTTCTAAAAAAA
ATCCTGGATTATCATTTTTTTTGTCAAAAGAGGGACAAGATCCAGATGTTGAAAGATTACTAGAAGGATT
TGCTTTCTTAACAGGACGATTAAAACAGCAATTAGATCAAGAATTACCTGAGCTATCAAATACTTTAGTA
CAACTTCTTTGGCCAAATTATGCTAGGGTTGTTCCATCGTATAGTGTTATTAAATATGATGCAGTTAAAA
ATGGAAGAGAAAATATTGTAATAAATAAAGGAACAGAAGTTTTAAGTAAATTAAAACCAGATACTATTCA
ATGTAAATTTAAAACAGTTTATGAAACAACTATTATGCCATTTGAATTAGAAAAAGTTAATTATTCAAAT
TTTGGTCAAAAAAGTTCTTTAAATTTATCATTTAAAACAACAAATTCTTCAACATTAAAAGATATTAAGT
TTGAAAGTTTAAGAATTTTTTTAAATGGTTCAGAATTTTTATCTCAAGATTTATATCTTTTTTTAATGAA
TTATGTAGAAAATATAGAAGTTATTTTAAAGAATACAGAAAATGAGAATATATCAAAAATCAAAATTGAT
AAAAATTCTATAAAACCAGTTGGTTTTGATTCAACTGAATATATGTTACCTTATTCGGCAAATATTTTTG
AAGGATATATATTATTACAAGAATATTTTTGCTTTAAAGATAAATTTTTATTTGTTGATATTCGTAATTT
AAACTTGATTGAAAAAATAAATAGTGATTTGTTATTTCAGTCTAATAGTTTTGAAATAAAGATTGATTTA
AAAAAAACTTTTTCATTTTCTGATACTTTAACAAAAGACAATTTTCTTCTTTATTCTACTCCTATAATAA
ATCTTTTTAATTCAGATGCTACTCCAATAAGAAAGACTTCAACACAAGAAGAATACTTAGTTTTAACTTC
TGAAATAAATAGGGAATTTAGTGAAATTTTTCAAATAGAAAAAGTTAGAGGTTGGTCTGATAAAAATAAA
AATTATCAAGATTTTTTACCTTTTGAATATTTTGCACATTCAAATGATGATAATGAACATTATTCTATAA
AAACTAAACTATCTTTAGATGGAACTCAAACAAATATATATGTTAGATTTTCGAATTTCTCAAAGGATAA
TTTATTATCTAATATGAATTCTACAATATCAATAAAAACTTTATCTACAAATAAAAATTTACCATCTTCA
TTAATGACAGGTGATATTTGTGTTTCGAGTTATTCTAATGCTAAGGATGAGACTCCTTTTAAAAATATAA
CTATCCCAACAAGAAGTTATCCTGCTCCTATAAAAGGAGATTTTTTTTGGAAAATTATTTCAAATTTATC
ATTAAATTATTTATCTTTAAAAGATATAAAAACTTTGCAAAAGATTTTAGAAGCTTATGATTTTATATCT
ATTTATGACAAAAAACAGAAAGAAAAAACAAAAAGAATATTAGAAGGATTAATAGATATAAAATTTGAAA
CAATGGAGTTTATTAATCAAGGATTACCAATAAAAGGTATTCATATAAAATTAAAATTAGATAAAAATAA
ATTTTCATCCCTTGGTGAAGCATATATATTTTCTTCAGTATTGAATAAATTTTTTGCTTTATATAATAAT
ATAAACTCTTTTCATAAATTAAGTGTAGATGTAATTAATGAAGATTCATTTGAATGGCCTATAAAAATGG
GTAATCAGTATTTAATATAA