SecReT6
Protein ID: 384173004
SecReT6 ID586
T6SS typei1
Gene symbol-
Locus tagABLL_2189
StrainArcobacter sp. L
Repliconchromosome [GenBank: NC_017192] [Browse all T6SS(s) in this replicon]
Location [Strand]2243538..2245013 [-]
Producthypothetical protein
NoteTssC
UniProt IDG2HY61
KEGG IDarc:ABLL_2189
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.70E-178, Aligned region: 64..489
Protein Sequence: 491 a.a.     [Download]
>gi|384173004|ref|YP_005554381.1| hypothetical protein [Arcobacter sp. L]
MLTKEQIENSQIRENNSLLDDIVSHTKLNKNDDSYNVVKNGVEALIQELINTDDSEERVNKSVIDKMIAE
LDRKISTQMDEIIHNKNFQELESRWRGLYLLIERTDFRQNILMEILNVSKEELMEDFEDCLDITQSGLYK
HIYTSGYGQHGGQPVGTIVADYELSPSNYDIKFLNKVSSIAAMSHAPFIAAAGPKFFGLDSFEGLPDLKD
LEDIINSPQFTAWRGFRQNEDSKYVGLTLPRFLLRAPYDPEDNPILNFSYKEDVSASHENYLWGNTVYAF
ASRLTESFASYRWCTNIIGPTSGGEVKNLPVHTFESMGDIEMKIPTEVLISDRREYELSEQGFIPLVMRK
GNNSATFFAASSVQIPKIFPDTEEGQIAQLNYKLGTQLPYLFAITRMSHYIKVLQREYIGSFRERADLER
ELNKWAKQYIANQENPSSEIRSKRPFKNMLIEVSDIVGDPGWYKVRIALRPHFKYMGANFELSLVGKLEK
E
 
Nucleotide Sequence: 1476 bp     [Download]
>gi|384170815|ref|NC_017192.1|:c2245013-2243538 Arcobacter sp. L, complete genome
ATGTTAACAAAAGAACAAATTGAAAATAGCCAAATAAGAGAAAATAATAGTTTATTAGATGATATCGTTT
CTCATACAAAACTTAATAAAAATGATGATAGCTATAATGTTGTTAAAAATGGTGTTGAAGCATTAATTCA
AGAATTAATTAATACAGATGACTCAGAAGAAAGAGTGAATAAATCAGTAATTGATAAAATGATAGCTGAA
TTAGATAGAAAAATTTCTACTCAAATGGATGAGATTATACATAATAAAAATTTTCAAGAATTAGAATCAA
GATGGAGAGGATTATATCTTTTAATAGAGAGAACAGATTTCCGACAGAATATTCTAATGGAAATTTTGAA
TGTATCTAAAGAAGAGTTAATGGAAGATTTTGAAGATTGTTTAGATATTACTCAATCTGGACTATATAAA
CATATTTATACAAGTGGTTATGGTCAACATGGAGGACAACCTGTTGGAACAATTGTAGCAGATTATGAAT
TATCTCCATCTAATTATGATATAAAATTTTTGAATAAAGTATCTTCAATTGCAGCAATGTCTCACGCACC
ATTCATTGCAGCTGCTGGTCCTAAATTTTTTGGATTGGACAGTTTTGAGGGATTACCTGATTTAAAAGAT
CTTGAAGATATTATAAATTCACCTCAATTTACTGCTTGGAGGGGATTTAGACAAAATGAAGATTCAAAAT
ATGTAGGTTTAACTTTACCGAGATTCTTACTAAGAGCTCCATATGATCCAGAAGATAATCCAATTTTAAA
TTTTTCATATAAAGAAGATGTTTCTGCAAGTCATGAAAATTATTTATGGGGAAATACTGTTTATGCTTTT
GCTAGTAGATTAACAGAAAGTTTTGCTAGTTATAGATGGTGTACAAATATTATTGGTCCAACTTCTGGAG
GTGAAGTAAAAAATTTACCTGTTCATACTTTTGAAAGTATGGGGGATATTGAAATGAAAATTCCAACAGA
AGTGTTAATATCTGATAGACGTGAATATGAATTATCAGAACAAGGATTTATTCCATTAGTAATGAGAAAA
GGTAATAATTCAGCTACTTTTTTTGCTGCAAGCTCTGTTCAAATTCCAAAAATTTTCCCTGATACAGAAG
AAGGTCAAATAGCACAATTAAATTATAAACTAGGTACGCAGTTACCTTATTTATTTGCAATTACAAGAAT
GTCTCATTATATTAAAGTTTTACAAAGAGAATATATTGGTTCATTTAGAGAAAGAGCTGATTTAGAAAGA
GAATTAAATAAATGGGCAAAACAATATATTGCAAATCAAGAAAATCCAAGTTCTGAAATTAGAAGTAAAA
GACCATTTAAAAATATGTTAATAGAAGTAAGTGATATTGTAGGTGATCCAGGTTGGTATAAAGTTAGAAT
TGCATTACGTCCTCATTTTAAGTATATGGGAGCTAATTTTGAATTATCTTTAGTAGGAAAGCTAGAGAAA
GAATAA