SecReT6
Protein ID: 384173005
SecReT6 ID586
T6SS typei1
Gene symbol-
Locus tagABLL_2190
StrainArcobacter sp. L
Repliconchromosome [GenBank: NC_017192] [Browse all T6SS(s) in this replicon]
Location [Strand]2245023..2245514 [-]
Producthypothetical protein
NoteTssB
UniProt IDG2HY62
KEGG IDarc:ABLL_2190
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.90E-50, Aligned region: 3..156
Protein Sequence: 163 a.a.     [Download]
>gi|384173005|ref|YP_005554382.1| hypothetical protein [Arcobacter sp. L]
MKQSESPKERINVTYKHSVGEALEDIEIPYKMTILGEFNPSEERKSIEEKKTININKNNFNEVIKAQNLK
LNFDVKNRLNNSNNDSIKIDLDIKHISDFSPEKIVEKVPELKKLMELRQSLIALKGPLGNVPAFRKAIES
LVQDTNKREQLLSELNLITKDNN
 
Nucleotide Sequence: 492 bp     [Download]
>gi|384170815|ref|NC_017192.1|:c2245514-2245023 Arcobacter sp. L, complete genome
ATGAAGCAATCAGAATCACCAAAAGAAAGAATAAATGTTACTTATAAGCATTCAGTAGGAGAGGCTTTAG
AAGATATTGAAATACCATATAAAATGACAATTTTAGGAGAATTTAATCCTTCAGAAGAAAGAAAATCAAT
TGAAGAGAAAAAAACAATTAATATCAATAAAAATAATTTTAATGAAGTAATAAAAGCTCAAAATTTAAAG
TTAAATTTTGATGTAAAAAATAGATTGAATAATTCAAATAATGATTCAATAAAAATTGATTTAGATATAA
AACATATTAGTGATTTTTCTCCTGAAAAAATTGTAGAAAAAGTACCTGAACTCAAAAAACTTATGGAACT
TAGACAATCATTGATTGCATTAAAAGGTCCATTAGGAAATGTTCCTGCATTTAGAAAAGCAATAGAAAGT
TTGGTTCAAGATACAAATAAAAGAGAACAATTATTATCTGAACTTAATTTAATAACTAAAGATAATAATT
AA