SecReT6
Protein ID: 384173006
SecReT6 ID586
T6SS typei1
Gene symbol-
Locus tagABLL_2191
StrainArcobacter sp. L
Repliconchromosome [GenBank: NC_017192] [Browse all T6SS(s) in this replicon]
Location [Strand]2245524..2246981 [-]
Producthypothetical protein
NoteTssA
UniProt IDG2HY63
KEGG IDarc:ABLL_2191
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.20E-05, Aligned region: 47..102
Protein Sequence: 485 a.a.     [Download]
>gi|384173006|ref|YP_005554383.1| hypothetical protein [Arcobacter sp. L]
MLRESILKEFDNFYGYDCKLEDNYLLIEQEIDKETSVNQEIIDYSFLITNCENYLCSNTKDIKLITLWFY
SKCKLEGFSGFIYSFDTYIKFLEKYFEQSFPNSKKSKINLLLWLETNLTNLVSKNDVFKKSIQSKQEIND
LFKKLSELFVTLTQKDERYFRNLLEITKETIIDIVNKTEKIVVQKLEKEITDVKSDFEANKLLKDVKTKI
KILSKYYRNKNFINITALRITRFLSWLEVDGLPLSEGSKTSIYPPQKDELLAIEELYSKKNFQEASILIE
EIIEVSPFWITGHYYIYNILIENKSYEYAEEIKNNLLSFIKTNQELLNLNFIDGSPFCNNESKIWIENEL
NSKEIILEKEETKEEDFLVLVNEYASRGKIKEAMKFFEKKVFASSNEEEKFNLIIEYVKFAIKFDKKEIA
LVLLEELEIKINIFNLTQWNPRLSAKVYHLILSNFTNIDFEPLKFENMYKVFCKLDIEKALEIKL
 
Nucleotide Sequence: 1458 bp     [Download]
>gi|384170815|ref|NC_017192.1|:c2246981-2245524 Arcobacter sp. L, complete genome
TTGTTAAGAGAAAGTATTTTAAAAGAATTTGATAATTTTTATGGATATGATTGTAAGTTAGAAGATAATT
ATCTTTTAATTGAGCAAGAAATAGATAAAGAAACAAGTGTTAATCAAGAAATAATAGATTATAGTTTTTT
GATAACAAATTGCGAAAATTATCTTTGTTCGAATACTAAAGATATAAAATTAATTACTTTATGGTTTTAT
TCAAAATGTAAATTAGAAGGTTTCTCTGGTTTCATTTATTCCTTTGATACTTATATTAAATTTTTAGAAA
AATATTTTGAACAATCTTTTCCAAATTCAAAAAAATCAAAAATCAATTTATTACTTTGGTTAGAAACTAA
TCTAACAAATTTAGTTTCAAAAAATGATGTATTTAAAAAATCTATACAATCAAAACAAGAAATAAATGAT
TTATTTAAAAAATTATCTGAACTTTTTGTAACTTTAACACAAAAAGATGAAAGGTATTTTAGAAATTTAC
TTGAAATTACAAAAGAAACAATAATTGATATTGTTAATAAAACTGAGAAAATTGTAGTTCAAAAATTAGA
AAAAGAAATAACAGATGTAAAGTCAGATTTTGAGGCTAATAAACTATTAAAAGATGTAAAAACTAAGATT
AAAATATTATCAAAATATTATAGAAATAAAAATTTTATAAATATAACAGCTTTAAGAATTACAAGATTTT
TATCTTGGTTAGAAGTTGATGGCTTACCACTTTCAGAAGGTAGTAAAACTTCTATTTATCCTCCACAAAA
AGATGAATTATTGGCTATAGAAGAGTTATATTCTAAAAAAAACTTTCAAGAAGCTAGTATTTTAATTGAA
GAGATTATAGAAGTATCTCCTTTTTGGATAACAGGACATTACTACATATATAATATTTTAATAGAGAATA
AATCTTATGAATATGCTGAAGAGATTAAAAATAATTTGTTATCTTTCATAAAAACAAATCAAGAACTTTT
AAATTTAAATTTTATTGATGGGAGTCCATTTTGTAATAATGAATCAAAAATATGGATAGAAAACGAACTT
AATAGTAAAGAGATAATTTTAGAAAAAGAAGAAACTAAAGAAGAAGATTTTTTAGTATTGGTGAATGAAT
ATGCATCAAGAGGAAAAATAAAAGAAGCAATGAAGTTTTTTGAAAAAAAAGTTTTTGCTTCATCGAATGA
AGAAGAAAAATTTAACTTAATAATTGAATATGTGAAATTCGCAATAAAATTTGATAAAAAGGAGATAGCA
TTAGTTTTACTTGAAGAATTGGAAATAAAAATAAATATTTTTAATCTAACACAATGGAATCCAAGATTAT
CTGCAAAGGTATATCACTTAATATTAAGTAATTTTACAAACATAGATTTTGAACCATTAAAATTTGAAAA
TATGTATAAAGTATTTTGTAAACTTGATATAGAAAAAGCATTAGAAATTAAATTATAG